CAZyme Information: MGYG000004899_02618

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_02618
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515	MGYG000004899_14|CGC1	57689.68	5.9737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 33163; End: 34710 Strand: -

Full Sequence      

MRRIEILLFSLCVAGLLCSCSSQKATSVQINGHGTQWQWDKGTIVVETPERPANQQSVIG
LALPKMDVVRVGFVGLGMRGPGAVERFTHIPGTQIVALCDYEQSRAEGCQKYLEKASLPK
AAVYSGEKGYEELCKRDDIDLVYIATDWLHHFPVAMCAMENGKNVAIEVPSAMNLKECWD
LVNMSEKTRKHCMILENCCYDWFEMNTLNMAQNGVFGEVIRAQGAYIHNLAPFWDHYWKN
GEDDKLGWRLDYNMKHRGDVYATHGLGPVAQALDIHRGDRMQTLVAMDTKSVVGKALVGE
RTDSACNNFRNGDHTTTLIRTANGKVIEIQHNVMTPQPYNRLYQLTGSKGFANKYPVSGY
ALDAEQLTASGVQPKVDDLNSHGFLPKEEMEALVEKYQHPILRKYGEMAKEVGGHGGMDF
IMDSRLVYCLQNGLPLDMDVYDLAEWCCLAELGELSMDNNCAAVAFPDFTRGEWNKVKGY
KHAYATPEEETATQEKAKAFTAKLKEQGAREWNAE

Enzyme Prediction     

No EC number prediction in MGYG000004899_02618.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	65	476	7.7e-160	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.15e-22	66	395	1	303	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.52e-13	69	194	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	3.41e-05	67	219	3	145	putative oxidoreductase; Provisional
COG4091	COG4091	0.002	69	180	18	149	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT44459.1	0.0	1	512	1	509
QRQ49631.1	0.0	1	512	1	509
QUU07042.1	0.0	1	514	1	511
QQT78254.1	0.0	1	514	1	511
QRP56502.1	0.0	1	514	1	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.00e-82	51	474	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	5.38e-69	69	478	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E9M_A	6.09e-07	105	307	39	214	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KWM1	0.0	1	515	1	513	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6L1Z2	0.0	1	515	1	514	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KYY1	1.59e-244	16	509	12	502	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	4.57e-212	44	485	32	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
P0C863	3.35e-211	44	485	29	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000042	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_02618.