CAZyme Information: MGYG000004899_00919

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_00919
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000004899_3|CGC9	42796.31	5.8797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 354514; End: 355632 Strand: +

Full Sequence      

MKLKCFILMLCVGAASCTAQRPKTEDVIGIITKVNNYWQQTHPEHERSFWDNAAYHTGNM
EAFFLTGNSDYYAYSEAWAEHNEWKGAKSDNKSEWKYSYGESDDYVLFGDYQTCFQVYAD
LYNVKPDSQKIARAREVMEYQMSTDKNDYWWWSDGLYMAMPVMTKLYKLTDNPLYLKKMH
EYWTYANSIMYDAEAGLYYRDAKYVYPKHKSVNGKKDFWARGDGWVLAALARVLKDLPET
DPNRPEYVERFQTLAKAVVACQQPEGYWTRSMLDPEHAPGPETSGTAFFTYGLLWGMNNG
LLDKAAYQPVVLKAWDYLTNVALQPNGRIGYVQPIGEKAIPGQIVDANSTSNFGVGAFLL
ASCEMVRFLNNH

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	367	5.7e-83	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.99e-108	30	369	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.93e-45	114	367	84	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00388.1	3.09e-250	1	370	1	373
QUT64861.1	3.09e-250	1	370	1	373
QQA30832.1	1.26e-249	1	370	1	373
QUT33910.1	1.26e-249	1	370	1	373
QUT62329.1	1.26e-249	1	370	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	4.13e-221	11	371	16	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	4.15e-176	24	369	13	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	6.22e-58	38	367	39	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	1.69e-16	32	365	23	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.04e-16	32	365	13	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	4.07e-57	38	367	46	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.72e-55	38	367	44	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.27e-48	150	366	199	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	9.25e-16	32	365	23	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000616	0.323367	0.675514	0.000179	0.000160	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_00919.