CAZyme Information: MGYG000004899_00711

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_00711
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1229	MGYG000004899_3|CGC1	140097.4	6.2976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 43116; End: 46805 Strand: +

Full Sequence      

MKNLYIAFWTVACLLVSLTGYAQSEWKNNFSTQGEILKTVGRGECSINDGVFRSKGAYAC
FGKPEWRNYTMSFKARAPKEAEQVQIWAGFRANNRFDRYVIGIKGGLQDDLYLMRMGYMG
TDEFMGVRPLGFHPVPGEWYRLKVEVCGNRIRVFLNDEKEPRMDIIDKNSDLAPSGPVTL
GGGWIETEFDDLVVTPLSEDALKNVKVAEYREVLTPQQKETKRQLERANYASVKVNALKE
GRTDISLDGNWLFMPGYELDDDEKAVSTTTDDKNWHVMSVPNFWNPIRIWLHGETMPSPT
GHQPKGVSDTYYQQETNRCEGYTFDYRKTNTAWYRQWIELPAEVEGKNLTLTFDAVSKVA
EIYINGKLAGSHIGMYGEIQVDGSKLLKPGKNLLAVKVTRKAEGSSSEGGSAAIDFFYSS
VRESEQEGGKVAVKTDILKDIAHGFYGDEPAGIWQPVKLTVTNPVKMEDVFIKPTLDGAT
FDLTVKNHSSKKNQFDLYTDIVDKETGSILYSSLSLQKLVLNAGEEKMFTYSVNGLKPRL
WTPQHPNLYDFRFRLVTAKGAELDCLAETSGFRTFEVKEGLFFLNGNRYWLRGGNHIPFA
LAPNNLNLADTFMQLMKAGNIDVTRTHTTPWNKLWMGAADKNGIGVSFEGTWPWLMIHST
PLPDAELIKMWREEFLTLLKKYRNHPSLLFWTVNNEMKFYDNDDDLERAKEKYRVISDVV
KEMRRIDPTRPICFDSNYQAKGKKEKYGANFMNSIDDGDIDDMHAYYNWYDFSLFRFFNG
EFQQKFKMPGRPLISQEMSTGYPNNETGHPTRSYQLIHQNPQSLIGYECYDFSDPKSFLT
VQAFITGELAEALRRSNDQASGIMHFALLTWFRQVYDYQKIEPYPTYYALKRALQPVLVS
AELWGRNLYGGDKLPTRIYVVNDRENGTALQPTLLRWEVQDETGKKLVGGSEELPAVKHY
GRYYVEPNIQLPANLPSDKVKAKLVLKLTENGLPVSENEYDLLLARKDWNRNQIAEGKKV
LLLDKDGVKNQLDFLHIDYQLVPTINELLDSKQKANLCIISGLTECTTEEKEMIRSYQSQ
GGKLLLLNSKEVAKTVYPEHITDWIIPTEGDIVNMERSDAPVFDGIDVLELRYFNNNKRE
IPLACNATLKVNRNENLTELAGQMKIHAYIDGGKPEDRIRKIDSMRGLTLLQIKEGKGTA
IVSTMCTEKADTDPIAGKLLVNMINELLK

Enzyme Prediction     

No EC number prediction in MGYG000004899_00711.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	233	1067	2.3e-84	0.7805851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.77e-30	333	901	66	636	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.79e-28	332	770	67	476	beta-D-glucuronidase; Provisional
PRK10340	ebgA	9.27e-22	270	740	66	480	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	4.68e-14	575	830	1	234	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam00703	Glyco_hydro_2	1.58e-11	465	573	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68995.1	0.0	1	1229	1	1229
ALJ60854.1	0.0	1	1229	1	1229
QUT88128.1	0.0	1	1229	1	1229
QUT46480.1	0.0	1	1229	1	1230
QRQ47307.1	0.0	1	1229	1	1230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ED1_A	3.59e-26	243	770	25	485	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6SD0_A	2.72e-24	245	696	40	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	2.72e-24	245	696	39	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6B6L_A	2.36e-21	246	732	9	434	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	4.11e-21	246	732	9	434	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.49e-23	245	696	40	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	8.57e-22	246	696	60	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
B4S2K9	6.90e-18	331	696	121	460	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1
Q32JB6	1.36e-16	246	735	54	488	Beta-galactosidase OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=lacZ PE=3 SV=2
Q04F24	1.37e-16	242	702	45	463	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000267	0.999133	0.000186	0.000144	0.000136	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_00711.