CAZyme Information: MGYG000004889_00227

Basic Information

• Species: UMGS1591 sp900553255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591; UMGS1591 sp900553255
• CAZyme ID: MGYG000004889_00227
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
890	MGYG000004889_5|CGC1	98952.25	5.0061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004889	2521508	MAG	China	Asia

• Gene Location: Start: 117; End: 2789 Strand: -

Full Sequence      

MDTNKLKVVPDQALVYDIDEIDGAMYMFSHLAGGSVIFRFEEAIDPARGAVLLNGRPHTD
WEITKFIFNDCPILLVHVRGYLNEYDTTAQIRISGFETPDGRQMDPQEFTIQVLPRRNSY
PEKYRGHDETALKAACESAVLLKNDGMLPLKGDAPLSLFGRGVAEYRRCAVGAARINPRG
CRSLEQAAGETSRFSLNRELLDFYRVPNNRIPPEDMLDRALAQSEAALVILTRGTGENID
NRPIPGEYYLSDEEDALLAAVTQKFEKVAVILNVGYPIDVRFLEKYAVNACLYTGLPGMF
GAEALFRLLDGRSNPSGRLPDTWPLDYYDTPASRNFLNFSAGEKLLQTDDPVWSQICYEE
GLYVGYRYFLSFDKPAAFPFGYGLSYTEFEQQVTDFRVEDDRVKVTVAVKNTGDRAGKDV
AQLYVSKPDAGLEQPAAELAAFGKTAVLEPGQAQALSLEIPLRHLASYRESTAEWVLLPG
RYTVSLGRHAGSLIIAGSFPQDGERIFQKAARRVAPPQVFDEISRKSVKSWPKGDGTFTS
AEPLLRNQLGHFVPPPSPLPKAEASISFGELAAAPEKLPDFVAQLTDDELCRLQVLWSTS
WQMNEKKIAGIIKGLQKYGMPDYVLADGNNGVNVARPNIGMPSSCMVAASFDTQLAYEVG
RVIAEEALDNGVDLILGPGMNLHRNLLNGRNAEYFSEDPLLAGYMAGHQTKGMQDAGVSG
CIKHVAANNCEAVRKRSNSLIRERTLRELYIRPYEYAMEIEPADTVMTGYNAVNGKFCDE
DYELLEGIFREELGFDGFAMSDWNSYDTSDTRAMVRAGISVLTPGSDDGRYVEPLKKALQ
AGEITRGELQRNVMRLLRVLCRRLKVRDYGNDCLEKEKPGKQRCFSGVRI

Enzyme Prediction     

No EC number prediction in MGYG000004889_00227.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	616	822	2.9e-53	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.09e-43	619	842	59	295	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	6.53e-30	125	487	381	751	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	5.12e-29	642	845	89	302	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.30e-27	139	366	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam14310	Fn3-like	1.56e-18	419	490	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79415.1	5.96e-238	11	866	16	877
QQA37022.1	2.99e-212	5	863	81	893
QLG40499.1	4.53e-203	12	860	25	886
SDU08918.1	2.82e-199	9	860	14	871
QQD64980.1	7.05e-198	5	860	81	890

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	3.47e-103	126	860	35	819	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X42_A	2.93e-58	127	508	324	720	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
2X40_A	2.93e-58	127	508	324	720	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	4.96e-41	602	860	11	286	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	1.83e-39	613	860	31	282	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	2.94e-112	129	857	11	759	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	6.34e-85	127	803	28	770	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
Q0CAF5	5.86e-41	617	857	35	280	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
A1DFA8	7.75e-41	617	856	35	279	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
Q4WU49	1.37e-40	617	856	35	279	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004889_00227.