CAZyme Information: MGYG000004880_00714

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004880_00714
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1254	MGYG000004880_6|CGC1	138963.91	5.1171

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004880	2890596	MAG	Spain	Europe

• Gene Location: Start: 6482; End: 10246 Strand: -

Full Sequence      

MTGKIDCFLACGDYASLKPMTDSLLGSGVVRHIHILVREAAEEDQTLPEGCTLMEACGMT
DTGTIKKMAAAATAEYALLLIKPVAVTLGMKAVERLLRVAADSGAALTYSDHWKIAGGER
TAHPVTDYQEGSIRDDFDFGSLLLIRTDMLQRYAETAPSYRYAALYDLRLYLSREGSIFH
INEYLYTEEETDMRASGVKQFDYVNPANREVQIEMERAATSHLTAIGAMVDTSAYTCPDF
NEQDFPVEASVIIPVRNRVKTIADAVRSALTQKTSFRYNVIVVDNHSTDGTTEAVGRLAS
AQEAAPDAPELVHIIPGRTDLGIGGCWNVAVNDVRCGRFAVQLDSDDLYSSDRTLQTIVD
AFYSQQAAMIVGSYRMCDFELNTLPPGLIAHREWTDENGPNNALRINGLGAPRAFFTPLL
RQVQFPNTSYGEDYAMGLIFSRSYRIGRIYDELYLCRRWSGNSDAALSVEKINANNTYKD
RLRTLEIAARRHMTDDSRQAGADNPLRRFMSRQMETWPDVRKRYRELHGVQEKELPCGAF
TLVAQHNPARIVSTGASIARAAIAARPCFLCEANRPAEQIKRNIDDGFELLVNPFPILPM
HFTIPARSHRPQLIGGSYGEIYRILDEYPELTVFYNGPKCGASAPDHAHFQAGTTGVLPL
QRDWQRLCRNLTPVADEGDGTGVWLVTDYPCPAFLVCSASAAGGERLFGMLYDALPLGGD
DVEPMMNIVCWRAGSDYISVVFPRRKHRPDCYSAEGDARFTVSPGALDMAGLMILPREDD
FGRITPDTALGILREVALTDEAAAAVAQRLREIHAAASAAGEASVACSTDSHAAALPHSE
PDVSVGIVSGQRISFSLNAAYTAKGETVEGEQTVEFSEGGILWNGNRYRELTFIPLAAGA
SFSLHDVTIGVNFHWERKETQVFCGTLRLVVEADKITAVNILPVEDYLVSVISSEMKATS
SLEFLKAHAVISRSWLLAQMEKRRRQKDGQDGFFSFIKRDDELIRWYDREDHTIFDVCAD
DHCQRYQGITRANNSAVVEAVAATRGRILTYGGEICDARFSKCCGGVTEEFQYCWEDTPK
PYLVSIKDCDSEGRDFCNTADREILSQVLNDYDCETPDFYRWSVEYTQEQLSQLISTNLK
EDFGAIIDLVPVEQGRSGRISKLKIVGTKKTFTIGKELEIRRALSESHLYSSAFTVVRED
IEGGVPQRFVLNGSGWGHGVGLCQIGAAVMGARGYSYGDILLHYYHGAEITRIY

Enzyme Prediction     

No EC number prediction in MGYG000004880_00714.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	250	390	7.6e-17	0.7705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	2.08e-97	618	801	2	185	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
TIGR02669	SpoIID_LytB	1.91e-53	937	1252	1	267	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG2385	SpoIID	2.09e-44	937	1253	137	393	Peptidoglycan hydrolase (amidase) enhancer domain [Cell wall/membrane/envelope biogenesis].
TIGR02870	spore_II_D	1.36e-37	933	1253	66	338	stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination]
pfam08486	SpoIID	1.08e-29	932	1050	1	100	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE82754.1	0.0	1	1254	1	1223
QVJ80566.1	0.0	1	1254	1	1223
QYR11045.1	0.0	4	1254	3	1245
BCS84357.1	0.0	1	1254	1	1252
QNT65264.1	0.0	1	1254	1	1259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RWR_A	6.36e-13	927	1250	51	317	2.1Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis],4RWR_B 2.1 Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis]
5I1T_A	6.53e-11	945	1254	67	330	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
5TXU_A	7.85e-11	945	1254	91	354	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0QYX7	8.55e-14	923	1251	88	352	Uncharacterized protein BHWA1_00569 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) OX=565034 GN=BHWA1_00569 PE=1 SV=1
P13251	3.95e-12	938	1251	72	331	Stage II sporulation protein D OS=Bacillus amyloliquefaciens OX=1390 GN=spoIID PE=4 SV=1
Q02113	2.34e-11	948	1251	422	703	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1
P07372	3.96e-11	938	1251	71	330	Stage II sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIID PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004880_00714.