CAZyme Information: MGYG000004879_02459

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_N
• CAZyme ID: MGYG000004879_02459
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		39287.98	5.7555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004879	3926800	MAG	China	Asia

• Gene Location: Start: 21720; End: 22757 Strand: +

Full Sequence      

MKIVVSKEKNGDCETIGEALEKARKYRKTGASDRIIIYIGKGVYQEKLVVDCQNISMIGE
NVQETIITYGDYAKKHMPDGTEYGTFRTATVRIDADYFLAENITFINASGNGKEYGQAIA
LYVEGDCVSFHDCRMIGCQDTLFTAPLPPKKKTGGNGHGPKAEGDRRNGRQYYDNCYIRG
DIDFIFGGATSYFEGCEIFSNYGVIEDEARLPEKGPDDRICGYVTAACTKQGQEYGYVFH
NCRFTSDCPANTVYLGRPWRDFAKTVLIDCKLGEHIKKEGWYDWGRTEARKTAYYAEYNS
HKDDEVARPNNIEREKWTFQLTKDEAEKYTRSRVLGNWDMEQTIQ

Enzyme Prediction     

No EC number prediction in MGYG000004879_02459.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	335	1.7e-89	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.97e-72	3	338	83	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.06e-71	3	336	2	296	Pectinesterase.
PLN02682	PLN02682	6.67e-52	3	330	71	356	pectinesterase family protein
PLN02745	PLN02745	5.56e-51	3	338	287	583	Putative pectinesterase/pectinesterase inhibitor
PLN02665	PLN02665	1.47e-50	3	329	70	348	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX41678.1	1.79e-112	3	338	5	337
AGF58031.1	1.30e-106	3	338	2	319
AQR96711.1	1.84e-106	3	338	2	319
BCJ93650.1	5.60e-106	5	338	10	321
SET76962.1	1.12e-102	3	339	2	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	9.16e-37	3	300	9	268	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	5.08e-32	4	298	6	262	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	5.91e-31	14	338	19	337	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	3.53e-27	10	300	16	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.80e-26	10	300	16	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O23447	4.75e-43	3	300	392	652	Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana OX=3702 GN=PME43 PE=2 SV=1
Q9FM79	1.06e-41	3	329	82	366	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LVQ0	4.00e-40	5	326	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q7Y201	4.88e-40	5	338	304	599	Probable pectinesterase/pectinesterase inhibitor 13 OS=Arabidopsis thaliana OX=3702 GN=PME13 PE=2 SV=2
Q8GXA1	5.53e-39	4	335	259	551	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004879_02459.