CAZyme Information: MGYG000004879_00359

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_N
• CAZyme ID: MGYG000004879_00359
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		40879.84	5.1357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004879	3926800	MAG	China	Asia

• Gene Location: Start: 7132; End: 8205 Strand: +

Full Sequence      

MNQNSTDPHSSDQELKELKMQFMQLVSITEQLQQKVLETERTNKVLVNANQQLIDWVNGL
QRDISDYQQNIRYELADPRCRDNQCIYPTIRPAAEAIDAIINEHKSLARFGDGEFSAISG
ASRQKFQEDDPVLAKRLQEVLRSNNPSVLVGIADNYGSLESYTEQAKREIRHYMTDRVRN
AHLSALNPQKTYYDAYLSRPYIMYADHDGNGPARRFLSLKRMWNNRHCIFVEGSETRMGI
GNDLFDNAASIQRILCPAVNAFCNYDEILDACKQQSKDALFILALGPTATVLAYDLANAG
YQALDLGHIDLEYEWFLQHKGVRTAIPDKYNNEFPDGDQVHEIHDPLYESQIILSIR

Enzyme Prediction     

No EC number prediction in MGYG000004879_00359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	108	333	4.1e-74	0.9910714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08759	GT-D	6.39e-104	108	334	1	223	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.
TIGR03728	glyco_access_1	1.24e-94	90	356	1	264	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL99919.1	1.62e-100	30	353	359	679
BAD48747.1	1.74e-67	81	356	31	302
ANQ60437.1	6.90e-67	81	356	31	302
QIK61699.1	1.03e-65	84	357	33	301
QIK56277.1	1.03e-65	84	357	33	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PFX_A	1.03e-49	90	356	14	276	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHR_A	1.03e-49	90	356	14	276	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PHS_A	7.95e-49	90	356	14	276	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]
5V4A_A	1.21e-46	95	356	13	271	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU2	1.81e-45	95	356	422	679	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
A0A0H2URB1	5.73e-40	95	356	555	812	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004879_00359.