CAZyme Information: MGYG000004879_00224

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_N
• CAZyme ID: MGYG000004879_00224
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000004879_3|CGC1	43807.08	4.8251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004879	3926800	MAG	China	Asia

• Gene Location: Start: 22005; End: 23141 Strand: +

Full Sequence      

MDVIVKYIDELLEKSTPQVPMWNIEKLKSGGKSTWNYIDGCMIKAVLEMYAISKDEKYLK
FADDFIDYRVNDDGTIDGYDVNEKNIDNVNAGKTLFELYDITGKEKYRKAIDLIYSQIEL
MPRTESGNFWHKNIYPQQVWLDGMYMGQPFYMEYETRFNNKKNYDDIFNQFKFVIENMRN
PMNGLYYHAIDTSKQMFWCDKVTGLSQNIWLRAIGWYSMALLDTLDKVDKEDEKYAAQCK
MLKDAYVDLMNAMIRYQDESGMWYQVVNFGGMEKNYLETSGSAIMAYSLLKGVRLGYLPE
SYRAYGQKAMDGICSKYLKTKEGEMSLGGICLVAGLGGNNNRPGTYDYYMSEPVVEDDAK
GVGPFLLAYTEILRCKNK

Enzyme Prediction     

No EC number prediction in MGYG000004879_00224.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	374	2.2e-116	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.03e-96	23	374	22	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.75e-83	35	374	27	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71682.1	3.06e-214	1	378	1	381
ABX40590.1	7.78e-211	1	374	1	372
CBL09353.1	1.28e-209	1	374	1	372
VCV21981.1	3.68e-209	1	374	1	372
AEN96572.1	4.10e-209	1	374	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.75e-103	35	371	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.55e-65	22	372	28	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.52e-65	22	372	18	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.36e-11	31	325	61	338	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.28e-10	31	313	62	329	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	8.47e-65	22	372	28	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.71e-41	146	373	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.71e-41	146	373	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	7.96e-20	35	313	29	286	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004879_00224.