CAZyme Information: MGYG000004876_02094

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004876_02094
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1229	MGYG000004876_24|CGC1	140260.76	6.4482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004876	4781463	MAG	China	Asia

• Gene Location: Start: 23597; End: 27286 Strand: +

Full Sequence      

MKNFYTVFWTAVCLLISLSGYAQSGWKNNFSDQGEILKTVGRGECSIADGVFRSKGSYAC
FGNPEWKNYTMSFKARVPQEAEQVQIWAGFRANNRFDRYVVGIKGGLQDDLYLMRMGYMG
TDEFMGVRPLGFHPVPGQWYQLKVEVCGSRIRVFLNDEKEPRMDITDKNSNLAPSGPVTL
GGGWIETEFDDLVVTPLEEDALKNVKVAEYRKVATPQEKESKRQLERTNYVSVKVNRLEE
GRTDISLDGNWLFMPGYQLDDKEKAVSTATDDKDWHVMSVPNFWNPIRIWLHGETMPSPT
GPQPKGVSDTYYQQETDRCEGYTFDYRKTNAAWYRQWIELPAGVEGKNMTLTFDAVSKVA
EIYINGELAGSHIGMYGEIQVDGSKLLKPGKNLVVVKVTRKAEGSASESGSAAIDFFYSS
VRESEKEDGKVAVKSNILKDIAHGFYGDEPAGIWQPVKLTITNPVKVEDVFIKPTLEGAT
FDLTVKNHSGKKNQFDLYTDIVDKETGSVLYSSLSLQKLVLNADEEKMFTYSVSGLKPRL
WTPHHPNLYDFRFRLVTAKGVELDCLSETSGFRTFEVKEGLFFLNGNRYWLRGGNHIPFA
LAPNDLNLANTFMQLMKAGNIDVTRTHTTPWNKLWMGAADKNGIGVSFEGTWPWLMIHST
PLPDAKLIEMWKEEFLTLLKKYRNHPSLLFWTVNNEMKFYDNDNDLERAKEKYRVISDVV
KEMRRVDPTRPICFDSNYQAKGKKEKYGADFMNSIDDGDIDDMHAYYNWYDFSLFRFFNG
EFQQRFKMPERPLISQEMSTGYPNNETGHPTRSYQLIHQNPQSLIGYECYDFSDPKSFLN
VQAFITGELAEALRRSNDQASGIMHFALLTWFRQVYDYQKIEPYPTYYALKRALQPVLVS
AELWGRNLYGGDKLPTRIYVVNDREDGTALKPTLLRWEVQDETGKKLVWGSEELPAVKHY
GRYYIEPSIQLPVNLPADKVKAKLVLKLTENGLPVSENEYNLLLARKGWNINQVAEGKKV
LLLDKEGMKDKFDFLHINYQAVSTIKEMMNPKQKADLCIISGLTTCTDEEREMLRSYQSK
GGKLLLLNSKEVAKTIYPEHITSWIIPTEGDIVNMERNDAPVFDGIDVLELRYFNNNKRE
IPLACNATLKVNRNENLIELAGQMKIHAYIDGGKPEDRIRKIDSMRGLTLLQIKDGKGLA
TVSTMCTEKADTDPIAGKLLVNMINELLK

Enzyme Prediction     

No EC number prediction in MGYG000004876_02094.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	230	989	9.3e-83	0.7194148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	7.20e-32	332	770	67	476	beta-D-glucuronidase; Provisional
COG3250	LacZ	7.22e-30	245	940	13	679	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.51e-20	247	740	44	480	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	4.47e-14	575	830	1	234	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam00703	Glyco_hydro_2	1.07e-12	465	573	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68995.1	0.0	1	1229	1	1229
ALJ60854.1	0.0	1	1229	1	1229
QUT88128.1	0.0	1	1229	1	1229
QUT46480.1	0.0	1	1229	1	1230
QRQ47307.1	0.0	1	1229	1	1230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GM8_A	2.55e-24	257	751	15	440	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5T98_A	4.14e-23	245	755	28	462	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
6S6Z_A	2.80e-22	245	696	39	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	2.80e-22	245	696	40	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6B6L_A	1.79e-21	246	732	9	434	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.35e-25	242	739	51	473	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
O52847	2.47e-23	246	696	60	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q56307	1.53e-21	245	696	40	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	3.66e-20	241	729	2	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	1.02e-18	235	696	39	432	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000240	0.999153	0.000176	0.000141	0.000133	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004876_02094.