CAZyme Information: MGYG000004876_01635

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004876_01635
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	MGYG000004876_16|CGC1	55671.15	4.5514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004876	4781463	MAG	China	Asia

• Gene Location: Start: 40805; End: 42283 Strand: -

Full Sequence      

MNNKIKIWTALCVAVCGIAFGACDDDKDLSYKGSLDLNMLGIKQASEIWDGAQCNISTSL
KEPQAGEVQKVDNFNYRLNLALYQNREAGKDATVDLVVAVDSLNKAIANVGTSSVYDVYA
NALLLPEEYYNLSANKMQLNAGNTKSEEVELNVYSSQLIALVQEEYKEDMKFVLPVRIQN
STSYAINGKTNTIMFFFNVTYVAPANPEDYVADSEGVPDDHTLEGGYKLLWHDEFNGTGA
PNAEMWRFEEGFQRNEEDQWYKKENAEMKENALVFTAKQERVKNPNYNPNATGGNSWKQT
REYAEYTSACVVATNNYAFKYGRLIVRAKVPIEQGGWPAIWSTGNWYEWPLGGEIDILEF
YKEKIHANLCWGGSSRWNGTWNSANYPITDFTSKDAKWAEKYHIWRMDWDEKYICIYLDD
VLLNKTDLSTTNNKGDHGAGDGGNINPFSNNIEGFGQLMMLNLAIGGNNGRPIEATFPLE
YRVDYVRVYQKQ

Enzyme Prediction     

No EC number prediction in MGYG000004876_01635.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	231	489	2.4e-51	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	3.25e-60	231	489	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd08024	GH16_CCF	4.81e-19	308	470	101	279	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd00413	Glyco_hydrolase_16	6.86e-16	233	489	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	6.49e-13	226	490	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam08522	DUF1735	2.69e-08	66	184	19	119	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58914.1	0.0	1	492	1	490
QUT89969.1	0.0	1	491	1	489
QQT78031.1	2.57e-176	1	490	1	510
QRP56725.1	2.57e-176	1	490	1	510
ASM65434.1	2.57e-176	1	490	1	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2N_AAA	4.67e-31	222	490	47	303	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]
4CRQ_A	3.27e-27	227	491	3	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	8.90e-25	227	491	4	233	Structureof Marine bacterial laminarinase [Aquimarina]
5WUT_A	1.02e-24	226	490	4	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
6XOF_A	2.87e-24	223	492	20	269	ChainA, GH16 family protein [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	1.96e-25	115	492	313	682	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q8N0N3	2.74e-19	307	470	132	305	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1
P45798	1.04e-18	227	490	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
Q27082	1.36e-15	224	490	22	253	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q9Z3Q2	1.69e-09	305	489	302	457	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000886	0.999175	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004876_01635.