CAZyme Information: MGYG000004876_00236

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004876_00236
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522	MGYG000004876_2|CGC2	59415.1	6.9125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004876	4781463	MAG	China	Asia

• Gene Location: Start: 34676; End: 36244 Strand: -

Full Sequence      

MRYKVLLFALAAITTSCTPQADTNYQIIAEQPLQVMEHFGASDAWSMHIIGKWPQERQNQ
VADWLFSTENDANGKPKGIGLSLWRFNVGAGSTEQGEASQIGSLWMRTECFLQPDGSYDW
NKQQGQRNFLRLAKERGVSKFLAFLNSPPVYYTRNGLATNTGRDGTLNLKDEHYEDFARF
LATMIKGVEKKDGIKFDYLSPFNEPDGHWNWIGPKQEGTPATKKEIARAVRLISKEFVKE
GIDTEIAICEASDYRCMFATHMTDHERGYEVQSFFCPDSVDTYLGNTPKVLPLISGHSYW
TTTPLNMLRDYRCQLRDTLDKYKTGFWQTETCIMGNDEEIGGGHGFDRTMKTALYVARII
HHDIVYAGARSWQWWRAIGGDYKDGLIREYSDTDLRDGKVEDSKLMWVLGNYSRFIRPGA
VRMSVQTTDKSGQVIPEGYTGPKGLMCTAYRNTNGQWVIVVINYADLEQNFTFDVSDSKV
KSWQGYRTSDIAGEDLLPIHKLKKRQLAVIPARSVTTFVSEH

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	24	519	1.2e-193	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.90e-148	34	387	13	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	1.08e-19	2	519	4	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	2.41e-05	419	518	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59968.1	0.0	1	521	1	521
QUT89019.1	0.0	1	521	1	521
ALJ60213.1	0.0	1	520	1	520
QUT88786.1	0.0	1	520	1	520
QDO68226.1	0.0	1	520	1	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	2.82e-96	34	521	17	497	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6IUJ_A	1.06e-18	9	521	7	472	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	5.81e-18	34	521	104	543	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
6M5Z_A	5.30e-15	5	519	13	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	2.18e-14	15	519	3	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	7.60e-15	20	519	24	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004876_00236.