CAZyme Information: MGYG000004876_00142

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004876_00142
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	MGYG000004876_1|CGC5	54677.55	7.9525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004876	4781463	MAG	China	Asia

• Gene Location: Start: 205299; End: 206777 Strand: +

Full Sequence      

MKRLSIFIVGVMVAVAAMSRTFDMRQLGADAKGIKPCTELINRTIEKAASEGGGTIYFPA
GTYLTATIHMKSNITLHLESGAVLRFSDKFEDYLPFVTARWEGTVMQTLSPLIYAHSADN
LTITGRGTLDGNGFKWWLWELDTRKVIKENGGKLPSLNKLQQMWVDANKDLEISDYYKPS
LERRMFRPPFIQFYECSNILIENVKIINSPFWTVNPAFCDNVTIHGVTIHNPSSNPKGPN
TDGINPSSCRNVRISDCFISVGDDCITIKSGRDADGRKYGKACENITVTNCIMLSGHGGV
VIGSEMSGGVRRVAISNCVFDGTNAGIRLKASRGRGGIVEDIRVDNIVMKNIQGDAFIFD
LFYDRLSKVEPVSERTPIFRNIHLSNVTGNDIQRIGYIKGIEEMPVSELSFSNMNMAAEK
GFRAETATDLRFNNVSFTVQEGPSLNFRQCKEIFLNDVRSKQPVGGQPVVNIEKDVEKVT
IIHCDSTQVVRN

Enzyme Prediction     

No EC number prediction in MGYG000004876_00142.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	48	427	8.7e-98	0.9353846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	7.85e-94	16	354	77	400	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	5.17e-36	89	392	29	273	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02793	PLN02793	1.77e-25	20	363	51	340	Probable polygalacturonase
PLN02218	PLN02218	3.91e-24	21	392	67	388	polygalacturonase ADPG
PLN02188	PLN02188	1.51e-22	4	407	10	353	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67958.1	0.0	1	491	1	491
QUT89414.1	0.0	1	491	1	490
ALJ59550.1	0.0	1	491	1	490
QDM11326.1	1.10e-292	1	484	1	483
QUT78461.1	1.10e-292	1	484	1	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.28e-77	20	413	26	407	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	2.67e-63	20	422	43	431	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	1.35e-23	16	469	151	606	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	1.01e-22	19	419	3	364	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MXN_A	2.26e-15	20	296	20	240	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	1.80e-48	45	430	89	440	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	2.01e-30	196	353	30	187	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P18192	1.74e-24	14	428	24	399	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
P05117	3.10e-24	117	456	162	456	Polygalacturonase-2 OS=Solanum lycopersicum OX=4081 GN=PG2 PE=1 SV=1
P15922	2.27e-23	17	438	147	576	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000548	0.998606	0.000234	0.000183	0.000182	0.000181

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004876_00142.