CAZyme Information: MGYG000004869_01319

Basic Information

• Species: Lactonifactor sp009677585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lactonifactor; Lactonifactor sp009677585
• CAZyme ID: MGYG000004869_01319
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000004869_11|CGC3	49074.68	5.2943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004869	4923116	Isolate	United States	North America

• Gene Location: Start: 283454; End: 284704 Strand: -

Full Sequence      

MGRVVRFTKRACSFLKRKGIRGIIDKINEEEMEPPKIETIEFYRYIMDRTEIPFSKEAYE
SHKMEETYLLNWVIPEMGVGSGGHTTIFRFVSNLENMGFHSRIYLHKSPNFKDNESLKEF
LRKYFPILDERVETYYDVSLAEYAHATIATSWSTAYFVRNFNNTISKFYFVQDFEPYFYA
HGSEYEFAENTYKMGFRGITAGDWLRDKLREEYQMETGSFHFSYEKKFYYPRERTDSVQR
VFFYARPVTPRRDFELGLLALDELCRRMPEVEVIFAGWDISNYNIPFKHQNKGILDMNGL
AECYAQSDLCLVISNTNLSLVPLEVMACNSVAVCSKGANSSWMVTEENAVLVDYDPNEIA
DTLEYYLTHEDEMEKYRKKGLAYVKDTSWLKEAEKVRDMLKNWIREDEAKLMESGK

Enzyme Prediction     

No EC number prediction in MGYG000004869_01319.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.59e-16	69	401	4	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03809	GT4_MtfB-like	4.04e-08	227	398	173	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
pfam00534	Glycos_transf_1	1.10e-07	241	380	5	155	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03800	GT4_sucrose_synthase	1.27e-05	240	395	222	395	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
cd03825	GT4_WcaC-like	1.84e-05	199	395	142	356	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYX25932.1	2.12e-184	1	407	1	404
AMK55186.1	4.80e-161	7	408	4	401
CCI71311.1	8.64e-103	18	400	23	404
AFY64819.1	4.41e-95	36	396	48	402
BBM51175.1	1.32e-93	16	410	10	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X0E_A	3.22e-08	70	363	49	373	Complexstructure of WsaF with dTDP [Geobacillus stearothermophilus],2X0E_B Complex structure of WsaF with dTDP [Geobacillus stearothermophilus],2X0F_A Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus],2X0F_B Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus]
2X0D_A	1.00e-07	70	363	49	373	APOstructure of WsaF [Geobacillus stearothermophilus],2X0D_B APO structure of WsaF [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	8.41e-29	21	402	875	1255	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004869_01319.