CAZyme Information: MGYG000004868_00836

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004868_00836
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000004868_133|CGC1	41317.05	4.8454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004868	1640537	MAG	Spain	Europe

• Gene Location: Start: 36; End: 1139 Strand: +

Full Sequence      

MILEDTELHPFYEIYPEKFSNKTNGITFRRWIHGANPALASLLDDVIGTDWRSTGDFSKL
ADFADDKSILERLAATKTEAKTIMRQFMALEQGVTIPSNAIFDVQVKRIHEYKRQQMLAL
YIIWKYLDIKNGNKPKHPVTIIFGGKAAPAYTIAQDIIHLILTLSQWIANDPDAAPYLQV
VMIENYNVTAAERVIPAADISEQISLASKEASGTSNMKFMLNGALTLCTLDGANVEIAEL
VGDENIYTFGASSKQVEQLYADGTYNAGALYRKPGIKLLVDFITNPAFMATGNAERLQRL
HDDIKGKDWFMALLDIEEYIQTKERVLADYEDQDAWMRKALINIANAGTFSSDRTISQYN
DEIWHLS

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	10	366	1e-120	0.5059347181008902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04300	GT35_Glycogen_Phosphorylase	0.0	2	366	429	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00343	Phosphorylase	0.0	2	366	296	661	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
COG0058	GlgP	3.77e-139	2	366	388	748	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	8.43e-115	6	364	433	794	maltodextrin phosphorylase; Provisional
PRK14986	PRK14986	5.20e-107	11	367	453	811	glycogen phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA54837.1	5.01e-257	2	367	390	755
ATP54275.1	8.21e-256	2	367	390	755
QIA34016.1	1.65e-255	2	367	390	755
AZH70366.1	5.22e-254	2	367	399	764
QUC04926.1	1.53e-200	2	366	387	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L22_A	4.84e-148	2	365	391	756	Crystalstructure of putative glycogen phosphorylase from Streptococcus mutans [Streptococcus mutans UA159]
2C4M_A	2.89e-96	2	366	416	788	Starchphosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_B Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_C Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_D Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae]
2GJ4_A	2.71e-89	2	364	451	814	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2FFR_A	2.76e-89	2	364	451	814	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
2GM9_A	2.76e-89	2	364	451	814	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29849	1.88e-157	2	367	386	752	Maltodextrin phosphorylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malP PE=3 SV=2
P73511	5.28e-92	2	366	461	826	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
P45180	3.48e-90	11	366	458	814	Glycogen phosphorylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=glgP PE=3 SV=1
Q9XTL9	1.46e-89	2	364	463	826	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
O18751	2.75e-89	2	364	463	826	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004868_00836.