CAZyme Information: MGYG000004866_01877

Basic Information

• Species: Gemmiger variabilis_B
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger variabilis_B
• CAZyme ID: MGYG000004866_01877
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620	MGYG000004866_37|CGC1	69846.69	6.4285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004866	2559588	MAG	China	Asia

• Gene Location: Start: 18586; End: 20448 Strand: -

Full Sequence      

MSEKPNNERPADLAVQDSVGGMAKRLLNPAHLRDLAKRGAATLHEQGAEQLWRDVKFRVG
LALHHDDWRHRADIPLRRELKAQRAANLQGPKISIIVPLYNTPAKFFDEMLRSVTRQTYQ
NWELVLVDASDPDKRLESRLPKSVPGTIVYEPIENGGIAANTTRGFELAHGDYIALLDHD
DVLYRNALFEVVQSIQNTGADFVYSDEIVLSADLKELGGYHFKPDFAPDYLRGVNFITHL
AVFSRPLLDAAGAYESKEFDGAQDHDLILRLTEKAQRIEHIKKVLYIWRGHAGSTAAGME
AKPYAIAAGERAIDAQLQRLGLPGRAMAVPDAPGAFQVRYELTGNPLISVLIPNKDHTDD
LDRCLTSLYKNAGYDNFEVIVIENNSTDPATEAYYQTIPGRFARCRVVRYKGAFNFSAIN
NFGAQFADGEHLLLLNNDIEVLSHDFLRELLSYSQRPDVGAVGAKLYYPDDTIQHAGVLM
GINGSAGHSHKSYPRTAVGDMYRLVTTQDYMAVTGACLMTKTALYRANGGLDEEKFAVAY
NDVDYCLKLWQRGLLNVYTPRAEAYHYESKSRGLDTLSENAKRYEREKANFYAKYQQYID
NYDPYYNPHFNNLFENFGLK

Enzyme Prediction     

No EC number prediction in MGYG000004866_01877.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	94	204	1.4e-19	0.6588235294117647
GT2	348	571	2.3e-16	0.9217391304347826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	4.92e-72	91	289	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.41e-40	350	568	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.74e-28	344	595	1	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.07e-23	94	295	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.28e-19	94	248	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC66692.1	4.23e-163	83	620	408	946
QUO22278.1	1.16e-161	41	605	46	614
CDM69534.1	2.88e-161	74	605	224	757
QNM02106.1	2.57e-160	91	605	116	663
QMW89744.1	9.76e-160	92	620	84	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	2.99e-08	91	205	5	119	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5HEA_A	3.72e-08	90	201	4	115	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.16e-118	90	587	365	866	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.18e-79	75	579	302	805	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2UR96	1.10e-10	93	203	5	116	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q1RIM7	1.66e-10	91	455	13	395	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
P71059	3.71e-10	91	294	3	217	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004866_01877.