CAZyme Information: MGYG000004865_01442

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; RUG023
• CAZyme ID: MGYG000004865_01442
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282	MGYG000004865_44|CGC1	33063.21	8.0807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004865	2913052	MAG	China	Asia

• Gene Location: Start: 9598; End: 10446 Strand: -

Full Sequence      

MELLYCGDRNAEDGILISLLSVLKQETAELHVRVLTMECRTSTHVYQKIPPFFAGYLDKL
AKEKNPGNWVRLYDMTSQFKAEPPAPNMETRFSPLCMLRLYVDLLDDLPDRLLYLDADVI
ARAPLDGLYNTDMEGYEIAGVLDYYGRWFFHHGRHVFDYLNSGVLVMNMVQIRKSGLLRR
CRHMCATQQLFMPDQSALNKLAAEKKLLPRRYNEQRRLHRRTILQHFTTSFRFLPWLHAV
TVKPWQVDRMHDVLHLHVYDDLLSQYAYHMSAIRSQGEVQNG

Enzyme Prediction     

No EC number prediction in MGYG000004865_01442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	4	238	7.5e-30	0.8638132295719845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	3.98e-24	116	246	103	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	2.31e-08	116	237	106	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	1.13e-06	116	213	105	211	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	3.16e-04	5	213	6	212	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ62930.1	1.30e-104	1	266	1	266
ANZ65909.1	1.30e-104	1	266	1	266
ANZ60115.1	1.30e-104	1	266	1	266
QNT44258.1	6.80e-100	1	266	1	269
AMV65062.1	1.87e-99	1	268	1	268

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URH7	2.81e-06	110	205	393	485	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
A0A0H2URH2	9.33e-06	110	199	95	180	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004865_01442.