CAZyme Information: MGYG000004864_02041

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004864_02041
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000004864_56|CGC1	38810.27	7.9406

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004864	2825139	MAG	China	Asia

• Gene Location: Start: 7412; End: 8494 Strand: +

Full Sequence      

MKRHKTLAILVGCLGGTVLLLGLLAGFVPQREGYEVRRRASPVVVSLRPEDMPVPIVPQG
DGSRQWSLRREASSVVALASPADTLSLADADAVAGGLFGQVPAGSGQLASLLALDGFSMP
LLLAVQPARFGDAVDARGLPLRWLAAETLLEGYSPLTPRAGRSAGRDGTGSALAANAYGN
GDTLPPRARRYQQLVESFAGRYNLSTELVYAIIHSESSFSPTLVSHKSAMGLMQILPDTA
GGEVHRYLYGHTGDVSFEDLRVPETNIRYGTTYLHILLTRYFSGVHDPRSREYCAVAAYN
MGPNRFLRLFGNSPEEAVDAINALTAEQLYEDLTIRLPVAETRAYVAKVARMKGHYAALQ

Enzyme Prediction     

No EC number prediction in MGYG000004864_02041.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	193	351	2.3e-23	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	1.07e-72	195	353	3	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	1.62e-41	126	356	130	356	membrane-bound lytic murein transglycosylase MltC.
cd16896	LT_Slt70-like	1.09e-38	190	349	3	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.14e-29	189	349	4	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15470	emtA	3.33e-29	139	351	1	198	membrane-bound lytic murein transglycosylase EmtA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD80276.1	3.80e-221	1	360	1	359
SPD35752.1	3.80e-221	1	360	1	359
VZH33299.1	1.49e-178	1	360	1	357
AMD88640.1	5.68e-148	1	360	1	379
QCC84560.1	3.47e-130	1	360	1	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.54e-33	121	356	107	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	4.14e-33	121	356	107	338	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
5MPQ_A	9.72e-10	191	359	416	558	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	9.76e-10	191	359	420	562	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	9.81e-10	191	359	426	568	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57K03	6.27e-34	123	356	128	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=mltC PE=3 SV=2
Q8Z3T9	8.71e-34	123	356	128	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella typhi OX=90370 GN=mltC PE=3 SV=2
Q5PMM0	1.21e-33	123	356	128	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=mltC PE=3 SV=2
A9MQR3	1.21e-33	123	356	128	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=mltC PE=3 SV=2
A9N4R0	1.21e-33	123	356	128	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999927	0.000054	0.000017	0.000000	0.000000	0.000024

TMHMM  Annotations     

start	end
7	29