CAZyme Information: MGYG000004856_00799

Basic Information

• Species: Raoultibacter timonensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Raoultibacter; Raoultibacter timonensis
• CAZyme ID: MGYG000004856_00799
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801		86129.41	4.8312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004856	3534823	MAG	China	Asia

• Gene Location: Start: 10097; End: 12502 Strand: +

Full Sequence      

MDIEAIVSKMTLEEKCDCLTGSDYWTLGGCPRLGVAPLVVADGPHGLRKQPGPADNLGIA
TSDPAVCFPTASASACSFDIDLMRRMGEAIGDEAREQQVDIVLGPGVNMKRSPLCGRNFE
YFSEDPHLAGELAAAYVEGVQSRGVGTSLKHFAANSQETNRLIVDSVIDERALHELYLEP
FRIAIEKAHPWTVMTAYNLVNGVYCSENSYLMDEVARGLWGFAGAFITDWGAENDNAASL
PAGLDLVMPGPRPDYRADVRTAVESGALEESLLDKAVERILKLHERCERHEAAFVVRDAQ
ARLSVAREVAEGSAVLVKNDGVLPLAADASIALIGAFAEAPRYQGTGSSKINPVALCCAR
EGFASRGATCAYAQGYDRKTGETDEDMLAAAVERARSAEVAVVFVGLPDAAEAEGSDRAD
MGLPDGHNRLVAAVCDVNPNTVVVVQGGAPVELPWRSRPSAILLSYLAGCEGGSATAAIL
FGDANPSGKLAETWPDRLADVQNANSYPAAGRQALYTESVYAGYRYYDAAEVEPAYPFGF
GLSYTTFAYSDLSIEGAGEGFDVSCTVRNSGARKGAEVVQLYVAPVDPCAFMVPQQLKGF
AKVRLEPGEEKRITMALPHRAFAHYDAGRGDWIVEGGCYEIRVSASSRDVRLVDTVLVPG
EVGHSDGVPDVYHRVEPGCFTNEAFLALYGRPFPKVLTAMRPYTANATVGDLRTSLIGRL
VQAALRRELKTLIPDDKEMRAAFDRAAMDTPLRAVAMSGIDMNVVKGVVDILNYRFIRGI
KRLRAVNSHAKDAESPRGERP

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	249	1.9e-64	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.15e-88	68	651	120	758	beta-glucosidase BglX.
COG1472	BglX	1.24e-63	31	355	56	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.60e-55	5	609	55	734	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	7.06e-55	314	544	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.72e-34	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS53563.1	5.20e-226	1	773	1	787
AGS53344.1	7.12e-226	1	773	1	786
BCL84647.1	3.88e-224	1	783	1	867
QQO08873.1	3.14e-223	6	685	11	692
AEF82048.1	7.10e-223	1	773	1	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	7.20e-201	1	662	3	672	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.17e-164	7	661	9	666	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.38e-133	3	661	4	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	9.74e-132	3	661	4	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.59e-102	2	662	5	840	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	3.94e-200	1	662	3	672	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	5.55e-157	7	661	9	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	6.13e-156	7	658	9	670	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P27034	5.31e-119	3	659	2	811	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A7LXS8	3.10e-115	3	651	46	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004856_00799.