CAZyme Information: MGYG000004848_01334

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004848_01334
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000004848_17|CGC2	42866.86	6.3151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004848	2237652	MAG	China	Asia

• Gene Location: Start: 53170; End: 54291 Strand: +

Full Sequence      

MKRNVVFLLACMFAMASVLPVSAGNTKTLKDVLGRYFLVGAAMNVDQIWNRTPDETNVVK
NNFNSIVADNCMKGEEIHPEENRFFWDDADRFVKFGQDNGLAIIGHCLVWHSQPPVWMFT
DERGDTVSRDVLIDRMHRHISAVVGRYKGRILGWDVVNEIFNDDGTFRNSPYYRIIGPEF
VELAFKFAHEADPNAELYINDYSLAKPAKRDAVCRIVRELKSKGYRVDGIGMQSHNGLEY
PDLDEYEKSIDAFAACGVKVMITELDVNVLPNPEKFGGAEISQNFKYADALNPYKNGLPE
EVEKEFEKRYLDIFNIYYRHRGQISRVTLWGVTDTRSWLNDFPVPGRVNYPLLFDRSNKP
KPVVDKIIKIFEK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	29	369	9.4e-102	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	1.21e-115	29	362	1	303	Glycosyl hydrolase family 10.
smart00633	Glyco_10	4.86e-108	72	367	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	9.63e-85	59	373	54	343	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34739.1	1.03e-274	15	373	1	359
CCG34761.1	1.03e-274	15	373	1	359
ANJ46993.1	1.24e-200	4	372	2	370
QJT73073.1	1.38e-185	28	372	26	370
BCS85462.1	2.68e-177	25	372	18	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PMU_A	3.40e-103	28	370	2	352	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_C Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_D Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_E Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_F Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306]
4PMV_A	3.52e-103	28	370	3	353	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306],4PMV_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306]
6FHE_A	7.89e-103	29	368	13	339	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]
2CNC_A	1.62e-100	23	370	30	377	Family10 xylanase [Cellvibrio mixtus]
1UQY_A	3.57e-100	23	370	21	368	XylanaseXyn10B mutant (E262S) from Cellvibrio mixtus in complex with xylopentaose [Cellvibrio mixtus],1UQZ_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with 4-O-methyl glucuronic acid [Cellvibrio mixtus],1UR1_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha-1,3 linked to xylobiose [Cellvibrio mixtus],1UR2_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha 1,3 linked to xylotriose [Cellvibrio mixtus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48789	1.48e-164	11	372	8	369	Endo-1,4-beta-xylanase A OS=Prevotella ruminicola OX=839 GN=xynA PE=3 SV=1
P49942	6.43e-141	1	373	3	374	Endo-1,4-beta-xylanase A OS=Bacteroides ovatus OX=28116 GN=xylI PE=2 SV=1
O69231	8.52e-84	37	368	16	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	4.52e-83	25	370	4	330	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
Q12603	7.98e-78	28	369	34	351	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000205	0.999208	0.000148	0.000153	0.000140	0.000127

TMHMM  Annotations     

start	end
5	24