CAZyme Information: MGYG000004848_01316

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004848_01316
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693	MGYG000004848_17|CGC1	79633.92	4.731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004848	2237652	MAG	China	Asia

• Gene Location: Start: 18401; End: 20482 Strand: -

Full Sequence      

MATTYKATWIWYPGDYEIWLGNKMNNRRTDRGAYFPPFWKQDSHYVTVEFSKAVELAEDE
ELKVEAEGSYNIKIDGKMLFGMPKKIKLDAGKHRINIKVHNQCTPPALYVDGKTVKTDGT
WNVTFEDKEWIDESGKASDTSSTVYMPAGFYNFDNIEQRPSQFKLERKRQEAVAAGNNVY
DFGKETFGYAILKGIKGNGTINIYYGESKEEATDKDHCETLDKLEVCNGVVTDLATNQTT
EITDDYVFGNSKAFRFICVETEGCSVSGVSMDYEFMPEEEKGTFRCNDEELNRIWEIGAY
TMQLTTREFFIDGIKRDRWVWSGDATQSYLMNYYLFNDNDMVKRTTWLLAGKAPITSHIN
TIMDYTFFWFNSIYDYYLYSGDSHFLTQIYPTMKTYMDYVLGRTDGDGMVEGMDGDWVFV
DWADKPMDKHGQLAFEQILFRKSLEAIAAVAKLTGNNEEGDTYQEKADALGKKLMQFFWN
EDKQALVHNRLNGKQSEDVFRYPNMFAIIFGYLDDEKQQTVKNSVILNEDVLRITTPYMR
FYELEALCMLNEQDKVMKEIKDYWGGMLKEGATSFWEKYNPDEHGTEKLAMYGRPYGKSL
CHAWGASPIYLLGKYYLGVKPTKPGFEEYTVEPALGGLEWMEGTVPAPFGLIYVKMDKSS
VTVKSDGGRGTLILENGKRNIEIPSGQEITIKL

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	174	662	6.2e-109	0.9603174603174603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.86e-30	279	615	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	1.08e-07	360	538	81	267	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	6.85e-06	360	482	336	465	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG4354	COG4354	1.67e-04	373	480	451	566	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam04685	DUF608	0.001	373	480	108	212	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT58576.1	0.0	2	692	16	713
ABR40300.1	0.0	2	692	16	713
QQY37560.1	0.0	2	692	16	713
QEW37285.1	0.0	2	692	16	713
ALK84934.1	0.0	2	692	16	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	0.0	2	679	13	699	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.82e-50	246	650	478	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	2.11e-31	287	617	212	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	1.19e-13	254	653	700	1109	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
P9WF03	9.61e-13	125	667	322	861	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004848_01316.