CAZyme Information: MGYG000004848_00336

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004848_00336
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000004848_3|CGC1	42759.31	6.4147

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004848	2237652	MAG	China	Asia

• Gene Location: Start: 32667; End: 33791 Strand: -

Full Sequence      

MNILNRFILLTAIFLSTLSVKAGGKADKVIEIINKVNHAWQQAHTDPGTPFWHNAAYHTG
NMEVWKLTGNKTYYDYSEKWAEHNKWMGARGNDPALWKYSYGETDNHVLFGDWQVCFQTY
ADLYMAEPDANKIARARQVMEYEMSTPNNDYWWWADGLYMVMPVMTKLYKITGNTLYLDK
LYEYWTYADKLMYDNDSHLYYRDAKYIYPKHKTNSGKKDFWARGNGWVLAALAKVLQDLP
KDNAHRQAYIDRYKAMAEAIAKSQQDGGYWTRSMLDADFAPGYETSGTAFFTYALMWGIN
SGLLDAETYAPVALKGWKYLSEVALQADGSVGYVQPIGERAIPGQVVGAESTADFGVGAF
LLAACEIARYYENK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	369	1.2e-78	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	9.75e-89	32	371	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.28e-45	52	371	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT64861.1	1.16e-190	25	370	26	371
QQA30832.1	1.16e-190	25	370	26	371
QUT33910.1	1.16e-190	25	370	26	371
QUT62329.1	1.16e-190	25	370	26	371
QUU00388.1	2.34e-190	25	370	26	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.83e-185	28	373	32	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	6.91e-154	26	372	13	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	7.71e-56	40	369	39	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	1.38e-18	52	373	41	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.76e-18	52	373	31	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	5.04e-55	40	369	46	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	5.83e-53	40	372	44	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.21e-40	152	367	199	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	7.53e-18	52	373	41	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999109	0.000181	0.000165	0.000150	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004848_00336.