CAZyme Information: MGYG000004847_00016

Basic Information

• Species: UMGS1670 sp902406135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Anaerotignaceae; UMGS1670; UMGS1670 sp902406135
• CAZyme ID: MGYG000004847_00016
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551		61265.39	3.9943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004847	2381643	MAG	China	Asia

• Gene Location: Start: 12010; End: 13665 Strand: -

Full Sequence      

MLRKKIAVLIAAVMTAQMSVPAFALEYSDVPRDHWAYSEIQKAGEIGFMSGMGDGTFGLG
QNVTRAQFVSMLVRMFGWSASEGTGFSDVAPGDWYYSDVLTASDMGVLDTTETYFRPNDN
ITREEMAVMIIKALGYGELAEEIANDGVPFSDVTENKGYISLAYEFGIISGRGGSIFDPN
GTALREDAAAMMVRCYDKYNSYVDFVHGFYAFSSYSQKDMASKMDTVSFGWSRMEYSDED
GVVVNTTTQNDNEWNVPEGYTDIVEYLKDNNVETNLNVYMSASESDDAETILSSAENRTA
AVNAIIEELTVDYRQLGYNPYSGVTIDFENLRGSEMRQNFTAFLTELNEELDSIGKSLYV
AVQPPMRSGAYFDGYDFKAIGEVCDKIIVMAYDYYAKTITSDVMESGFTTTPVTPFDEVY
YALKVITDENTGVADKSKVVLGLSMSNVGWTVVDGVIVNSTGKTYTYEEIADMINNGAEV
KYSDKYKNPYIVYDDGEEKQIIWYEDETSVKDKIKLAEMFGIDGISIWRIGLIPEEGGNL
DIWSGITSLTK

Enzyme Prediction     

No EC number prediction in MGYG000004847_00016.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	209	531	4e-37	0.8074324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	7.35e-38	256	532	43	304	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	4.45e-28	274	532	168	409	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	3.93e-23	284	532	78	333	Glyco_18 domain.
pfam00704	Glyco_hydro_18	6.95e-22	282	531	73	305	Glycosyl hydrolases family 18.
cd06549	GH18_trifunctional	3.30e-18	210	531	12	291	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX64072.1	1.04e-165	7	535	13	549
QHI71217.1	6.01e-154	2	538	5	546
QIB69198.1	6.01e-154	19	538	25	546
QAT42616.1	1.20e-153	19	538	25	546
QGG48974.1	1.21e-146	27	551	35	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WIW_A	1.78e-13	299	536	111	335	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
4Q6T_A	3.31e-10	321	551	114	340	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4S3J_A	4.40e-09	324	532	215	412	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
5GZU_A	5.26e-09	335	528	659	863	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	5.67e-09	335	528	910	1114	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38535	6.65e-17	24	201	905	1086	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P38536	4.19e-16	27	198	1682	1857	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P19424	1.06e-12	24	192	38	210	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
C6CRV0	1.23e-12	27	194	1283	1457	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P36917	5.98e-09	32	126	1060	1155	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999007	0.000187	0.000185	0.000172	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004847_00016.