CAZyme Information: MGYG000004845_01477

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000004845_01477
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	MGYG000004845_12|CGC1	59615.26	4.3304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004845	2789282	MAG	Sweden	Europe

• Gene Location: Start: 32308; End: 33906 Strand: +

Full Sequence      

MDIYKIKEINYKNAGDACRMWLGDINGDGIMEIVMVQPDGGFDDRFYPHSVQCATAFDLD
GNMLWQIGEPDPEVHGSGSDIPAQIYDIDRDGNNEFICVMNDELCIFDGKTGELKEKHGL
PDKDAHDCIIIADLEGTGYAQNIIVKNRYRKLWALDRNYEVMWTFEGDVGHYPWVYDLNR
DGCDEVIAGYTVLDASGKPMWRIDMEDHADCIWVGDLMQNGQPLVMVGGADTTAYTADGR
LVWRFTDTVESQNIAPGKFILGKRGLQIAGLDRIVRVGDNGKDGIFLFDCNANPLYKEDR
KSIGWSTIVTVMHGFTRSAQDYILAYRRGGGLTGGVYDGEMNCLLELPYDGHCMWADLTG
DGLSQLLLYNGEKITIYSTEQTDLLKPAINSPRPQPKRLYNWTRYWGSEIEPERYAVGYV
TGDFENCDIKKWAQSCNNDENITIADFAVLLVNALGLKAYYTENFKDVLSCDYFVKAAGI
IKALGIIEGDTLEPDSYVSIEDANKMLDKAGAKKRIDGDGFVTMNMAARVFE

Enzyme Prediction     

No EC number prediction in MGYG000004845_01477.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	1.52e-07	20	217	114	368	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY76765.1	6.84e-156	1	410	1	415
AIQ73155.1	1.76e-149	3	410	9	421
AIQ45990.1	3.81e-149	3	410	1	413
AWV32499.1	7.09e-149	3	410	9	421
QNK57848.1	1.62e-147	6	409	11	421

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004845_01477.