CAZyme Information: MGYG000004837_01248

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D
• CAZyme ID: MGYG000004837_01248
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
132	MGYG000004837_69|CGC1	14944.94	7.0108

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004837	1914208	MAG	China	Asia

• Gene Location: Start: 9652; End: 10050 Strand: -

Full Sequence      

MKDIWTNQFDAFASIANYLHTVGWDNKLPWGVEVTLNQPLDLSLSGIEKNKARSLSDWQS
KGVTLASFSQQEQDKLTALSQADLWLVRPDKEVGRAFLVSNNYRTILDWNKSNYFGVSIG
MFADRIKMATGL

Enzyme Prediction     

No EC number prediction in MGYG000004837_01248.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	2	127	7.3e-35	0.39661016949152544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02283	MltB_2	1.50e-39	2	127	180	299	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	1.77e-34	2	132	219	341	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
pfam13406	SLT_2	1.46e-32	2	124	179	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR20568.1	2.30e-90	1	132	241	372
CBW15854.1	3.07e-90	1	132	239	370
QOR09609.1	1.16e-89	1	132	237	368
QOR07763.1	1.28e-89	1	132	240	371
VEI31968.1	1.29e-89	1	132	229	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ANZ_A	4.78e-17	2	127	225	344	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]
5AO8_A	4.78e-17	2	127	225	344	CrystalStructure of SltB3 from Pseudomonas aeruginosa in complex with NAG-NAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004837_01248.