CAZyme Information: MGYG000004830_00693

Basic Information

• Species: CAG-485 sp900549375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900549375
• CAZyme ID: MGYG000004830_00693
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000004830_4|CGC3	37911.17	5.7102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004830	2642212	MAG	China	Asia

• Gene Location: Start: 166746; End: 167765 Strand: -

Full Sequence      

MKRILVAAWAAVMAAVAANAAEPFWLGGDISGMTADEARGRYVMNSDSVRTETTQLMKDY
GMNATRLRVWVNPTDGFCSPQDVLKMAKRSKELGMSVMVDFHYSDWWADPGKQNPPAAWL
GKNLEQTCDSVAAHTRFTLQLLKDNGIDVKWVQVGNETTHGFLWPMGRFEENPENYATLT
KAGIRAVREVYPDAKVIIHLDNGFDKGLYDRVFDSLKSNGVEWDIIGMSVYPYWAMEAGH
EQSDIMTLVDTIENIRHLKKKYGTNVMIVETGVDGRNPLPGKEFIAALIKASRDFTDGAC
KGVFYWAPEWDAEGDYRLGAFTKGRPTIIMDAFKEAAGK

Enzyme Prediction     

No EC number prediction in MGYG000004830_00693.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	27	312	2.3e-89	0.8918128654970761

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	9.18e-92	27	315	3	304	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	4.32e-84	22	310	37	344	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
cd19608	GH113_mannanase-like	0.003	71	315	53	286	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF26228.1	2.65e-130	1	334	3	333
BCS85804.1	8.95e-119	1	333	1	333
AGB28883.1	3.71e-115	22	337	23	336
SCM59778.1	3.01e-110	24	334	39	359
QJR97948.1	1.72e-97	24	337	13	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GPA_A	4.18e-82	22	334	5	314	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
6GP5_A	1.34e-81	22	334	41	350	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OSK_A	2.05e-42	30	310	51	356	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
4BF7_A	5.07e-41	27	310	23	317	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJQ_A	9.77e-39	27	310	6	300	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	7.53e-51	22	310	4	312	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
A1D3T4	3.25e-45	27	310	27	323	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
B0XPR3	8.94e-45	27	310	27	323	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
Q4WJ80	3.45e-44	27	310	27	323	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
Q0CTQ7	4.11e-44	27	310	20	316	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000678	0.998073	0.000328	0.000334	0.000313	0.000278

TMHMM  Annotations     

start	end
5	27