CAZyme Information: MGYG000004829_00994

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000004829_00994
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
907	MGYG000004829_8|CGC1	97616.09	10.0924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004829	2982638	MAG	Spain	Europe

• Gene Location: Start: 38655; End: 41378 Strand: +

Full Sequence      

MSHRVPDNQDAAARPPERPLSQEPAGAHEAPRADDLPKSAPFMTIDPSKGAEASAPAVPA
APAAASPAETQPAKPQRDQSPQNSEKSSKSPVSSNKPSAQKPARPRGFASRLLRFFGWLF
AFCAAFAAAAGLLFWWWTAELAREPAPPLLDGVPFSTAYYSDDGRLLRLSPASDGIFRLK
TPLSGIAKEAVIATVFYEDRYFRKHPGVNPFALVRAAFATFTGSRPIGASTITMQVARLR
LHLETRSLEGKFRQIEAALRYEAHYSKDEILEAYLNLAPYGGNIEGVGAAARLYFHKDAA
ALAPGESVGLAVVPQNPVKRRPWQGPDFDRARIRLAKAAVLAGVFPRSLEPALAGPLAVG
DPAQNPFEAPHFVRLLESLGAGAQAHNGIVRSTLRLDLQDRLEGVVHRAVARLRPWGIRN
AALAVVDVRDKSLLALIGSADFFDDAISGEVSAYRAPRSPGSTLKPFVYGLALDQGLIHS
KSILADSPANFAGYAPENADGRFRGPVNATTALVESRNLPAIELARSLRPDLYDLLTRAQ
VSLPFDRAHYGLSIVLGGAEVTMEDLAGLYASLASSGIWAPLRLLRDAPGDAPKTANAAP
APRPLLSPEAAWIVGRMLETRGESIRIREKRFPLIYKTGTSNGFRDAWAAGWVGPYVIVV
WSGNFDGRPNGYFQGATLAAPLFREAAAALASAPSLDWPDDYAGPVTKAPEALNVAQENV
CRATGDVGNALCRDKTKAWFIPGRSPIRDSGVFREILINKKTGLRACRNEPGRTEKRVWE
FWPSHYQRMFLAAGIVKRPPPPFEPGCESFARLEASGSPGQAPVILSPKRGVAYFTGTAG
RSRAAVLLEAGLSPEARTVYWFDGSVFLGAARGGATISKSFSPGRHRLTATDDFGRSSAV
TLHVRTP

Enzyme Prediction     

No EC number prediction in MGYG000004829_00994.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	180	332	2.1e-41	0.864406779661017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4953	PbpC	0.0	145	904	25	731	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02073	PBP_1c	0.0	146	904	1	726	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK11240	PRK11240	2.58e-113	173	900	57	767	penicillin-binding protein 1C; Provisional
TIGR02074	PBP_1a_fam	2.39e-97	188	685	15	523	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.30e-94	153	685	52	591	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA55368.1	2.91e-285	143	905	66	810
QQS90091.1	1.07e-274	142	905	99	860
BBF22797.1	1.06e-256	145	905	33	800
QTO41888.1	8.68e-205	141	905	33	768
VZH32198.1	1.03e-203	141	905	76	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	1.49e-36	159	684	137	687	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	1.66e-36	159	684	158	708	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	1.42e-34	159	684	141	691	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
4OON_A	6.16e-28	160	683	24	715	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2JE5_A	1.43e-26	157	579	43	509	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	5.65e-99	148	900	35	765	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q9KUC0	4.18e-37	167	670	162	695	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P38050	2.85e-36	183	685	72	592	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P02919	1.23e-35	159	684	194	744	Penicillin-binding protein 1B OS=Escherichia coli (strain K12) OX=83333 GN=mrcB PE=1 SV=2
P40750	1.90e-31	160	664	59	597	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
115	137