CAZyme Information: MGYG000004823_01500

Basic Information

• Species: CAG-462 sp900765575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900765575
• CAZyme ID: MGYG000004823_01500
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267	MGYG000004823_81|CGC1	31590.25	7.7158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004823	3872922	MAG	China	Asia

• Gene Location: Start: 8848; End: 9651 Strand: +

Full Sequence      

MHQYLLGTFYRNKGYNVCFDPTFFKERGNDLNEEFVRNFDLLKVFPYLPYHTILSKAEVF
FYKHKFYYEGNNTNLRTNNFGFLDKKPPIYLGGYYHLPPSIWLQLFQSLFHIDPSILCNT
DKHLFDCIKKQTCPIAVHVRRGDLKVEIYGYGKPASIDYFQKAIIYCNEHFKTPYFYFFS
DEPQWVKENLIPTLTLQNNYKIIDFNGSDKGYIDLLLIAACKHQITSKGTLGKYGALLDD
NEEKTVILYNDEIEQHWKPLLKNPVYL

Enzyme Prediction     

No EC number prediction in MGYG000004823_01500.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	104	255	4.4e-32	0.5144927536231884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.38e-32	1	249	15	251	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.23e-09	135	267	166	297	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK86625.1	1.42e-108	1	267	37	303
QUT65922.1	1.42e-108	1	267	37	303
QUT61384.1	4.04e-108	1	267	37	303
QQA29876.1	4.04e-108	1	267	37	303
QUT37211.1	8.13e-108	1	267	37	303

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004823_01500.