CAZyme Information: MGYG000004823_01493

Basic Information

• Species: CAG-462 sp900765575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900765575
• CAZyme ID: MGYG000004823_01493
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000004823_81|CGC1	46481.91	8.2426

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004823	3872922	MAG	China	Asia

• Gene Location: Start: 606; End: 1808 Strand: -

Full Sequence      

MMKNTINRLILCGAVCCSVSLFAQKKVSTELPWSVRVAESEMIRFPESWQLDFQPTLKWD
YCHGVELQAFLNLYDAYGDKKYFDYALTYCDTMTHADGSIVTYRPSELSLDRINTGKIYF
RIYEQTKQEKYKWAMENMRAQLVAQPRTTEGGFWHKQVYPHQMWLDGIYMASPFYAEYAF
RNNRPQDYQDVIRQFKVVAKHTYDPKTGLYRHAWDEKKAQKWADKKTGQSAHTWGRAMGW
FSMALVDALEFIPKHEAGRDSVMAILDNVATQIKRWQDKDSGVWYQVIDRSGEAGNYLEA
TVSAMFIYTLYKAVRLGYIDASYLDVAEKAYNGFQKQFVKVDKDGVVSVSNCCAVAGLGG
NPYRSGDYDYYIHERIRDNDPKAMGPFINLCLERERLQKK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	53	396	5.8e-117	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.61e-122	33	398	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.67e-103	53	397	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77882.1	6.58e-205	1	400	1	399
BCA48645.1	3.63e-203	18	399	4	384
QQA07820.1	4.41e-203	9	399	10	399
AAO79213.1	4.41e-203	9	399	10	399
QMW86461.1	4.41e-203	9	399	10	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.83e-106	59	397	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.58e-83	52	397	32	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.07e-82	52	397	22	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	3.76e-20	42	336	48	330	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.15e-20	42	333	49	328	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.41e-82	52	397	32	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.45e-39	170	388	1	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.45e-39	170	388	1	222	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.01e-17	53	304	23	262	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.019432	0.578394	0.399719	0.001386	0.000578	0.000451

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004823_01493.