CAZyme Information: MGYG000004822_02718

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004822_02718
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576		65576.87	8.0154

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004822	3489319	MAG	China	Asia

• Gene Location: Start: 391; End: 2121 Strand: -

Full Sequence      

MNLHAQENQSYFLHTIEKGQSLYSISSMYGVSQSDIIQLNPGCEEKIYAGQTIRIPQKQK
ASKQDEKFHTIEAGETLYKLTTIYNVSAKAICEANPGLSAENFRIGQVIRIPSAEEVAQT
TATPLTQNVTATSPSTATIQGPVQSRCKDMHKVKRRETIFSVSREYGISEQALIDANPEL
KQGMKKGQFLCIPYPSAKPVTPQENKDITPPTDKELFLASKEAPEKISTIKAAILLPFLQ
DKRMVEYYEGFLLAVDSLKRTGTSIDLYAYNCGDDNASLNNILAKDEMKKMNIIFGPSQS
KHTKTLAAFAKKYDIRMVIPFSSKEEEVFSNPFIYQINTPQSYLYSEVYEHFIRQFSNAN
IIILEATAVDKDKTEFIKGLKQELTNKRIPVKTRPESATAQAMKEALRSDKENIFIPTSG
SDVTLIKIIPQLTVLVRENPDANVHLFGYPEWQTYTKDHLDSFFELDTYFYSSFYTNNML
PAAINFINSYHKWYSKDMAINYPQYGMLGFDTGFFFLKGLSRYGSELEKNLPKMDLTPIQ
TGFKFQRVNNWGGFINKKVFFVHFTKNFELVKLDFE

Enzyme Prediction     

No EC number prediction in MGYG000004822_02718.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.08e-08	14	55	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	1.29e-08	14	56	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK13914	PRK13914	1.29e-08	16	222	32	273	invasion associated endopeptidase.
PRK06347	PRK06347	1.61e-08	14	166	408	565	1,4-beta-N-acetylmuramoylhydrolase.
cd00118	LysM	1.98e-08	67	111	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT76029.1	0.0	1	576	20	594
QCQ50409.1	0.0	5	576	23	589
QKH83237.1	0.0	5	576	23	589
QTO25073.1	0.0	5	576	23	589
QCQ33253.1	0.0	5	576	23	589

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	3.14e-06	14	111	633	736	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004822_02718.