CAZyme Information: MGYG000004819_00931

Basic Information

• Species: Limosilactobacillus ingluviei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus ingluviei
• CAZyme ID: MGYG000004819_00931
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	MGYG000004819_11|CGC2	92288.21	9.1575

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004819	1939904	MAG	China	Asia

• Gene Location: Start: 10997; End: 13537 Strand: +

Full Sequence      

MKNNVDQIRAYQANFARNVKKVTTLSGVVLATASFLLLVQPQAAQAETTPATTVSQAASA
ASQASAPATPVSSASNASASSVVASASASAPTSAVNSASSSASVSAANATASSSESALYK
AADANTPTVATNPDVVASAVNTTSAPNIKTYTPSNNAGSVTNKGSYSTSADAIDVSSYQG
AMSVNDYTNLKNQGVKYVIVKLTQGTTYVNPYAGTQIANAKAAGLTVYAYDYVTFTSTGA
AQAEAAYFAAAARRFGLGTDTLMIADVEDDVVKRGDITSLLNAYWAALSAQGFTNHAVYT
GYYFDQQYKVSSTVGKSRTWIAAYYYSYWKNTILNSGYGAWQYTDSFNGIDGSIDMGLFS
SNVAKNGESYENGHWYLYQGGVKQTGFMRLTDGRVVYYNGAGQMQYGLQTINGATYYFRT
DNGNMVTGQTTVNGSSYYFDPKTGQRQTGLVYNQAGKTFQYYDLTTGKLLTSANGTYVGT
LHVQANGTVDLKTLTNGLNVINGVRYYYNATTQTLVSGLMTVNGKTYYFDPITKKSVSGQ
LLLNGYWYGFSSDGIMQTGFTKIADGRIVYYDPQGHMMYGEQKINGAWYYFATDNGNMAT
GFTKLKDGRTVYYNMAGQMQHGLTNVNGTYYYFADDNGNEQTGLRIIGGKTYYFAPAILK
AAERRVNGYWYYFKADGSMATGFTKLSDGRTVYYNNQGHMVYGEQHLNGAWYYFATDNGN
MAKGFTKLPNGRLVYYNEVGQMQHGLTNVNGTYYYFADDNGDQQTGFKKIDGKMYYFAPM
MLKNTERQINGYWYYFKADGSLTTGFTKLSDGRTVYYDQSGHMLYGKQLINGKWYNFRKD
NGDMIN

Enzyme Prediction     

No EC number prediction in MGYG000004819_00931.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	173	347	2.6e-34	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06522	GH25_AtlA-like	5.08e-49	171	355	2	191	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.
NF033930	pneumo_PspA	2.48e-29	600	835	443	634	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.26e-28	655	835	480	657	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	6.18e-27	523	694	449	614	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.82e-25	580	836	487	684	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLL69463.1	1.65e-171	1	565	1	558
QLI94817.1	4.44e-129	166	835	47	770
QOL69899.1	3.06e-117	166	834	195	920
AMS07659.1	1.19e-47	170	372	135	344
QFG72957.1	1.82e-47	171	418	94	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	2.21e-06	173	282	19	127	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
4KRU_A	4.40e-06	173	363	23	211	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	9.48e-06	173	363	23	211	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P34020	1.54e-06	173	367	4	188	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P26836	9.19e-06	163	363	2	200	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003334	0.995234	0.000760	0.000245	0.000208	0.000198

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004819_00931.