CAZyme Information: MGYG000004816_00007

Basic Information

• Species: Phascolarctobacterium_A sp900757795
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900757795
• CAZyme ID: MGYG000004816_00007
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	MGYG000004816_1|CGC1	60137.07	9.1952

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004816	1941300	MAG	China	Asia

• Gene Location: Start: 7379; End: 8962 Strand: +

Full Sequence      

MQRKYWLAFWLAAVLLLFFGNGQLLVTDSVESNYALTAKEMVLSNDWLSPQIYGHYWYDK
PIMFYWLTALAFKIFGFTEFAARFFPALFGLAGLGLVCYGGYRLYDEKVGFFSGVLLLSS
IEFFLISKSIITDAVLFCFFSASLLFFYLGYKENKAVFWYLMYASAGLAVLTKGPIGVLL
PGLIITLFLLWQRDWRVLRRCKFFSGVLLCTVIAVPWYAAMYSLHGSDFINTFFGVHNFL
RATVSEHPRDNVWYYYLLVNILALFPWSALVPMCLWRRYRQQQPLEEQKKFLLLWAAAVF
CFFQCVATKYITYTYPLLFPMSIFLAQELVKEHKPFLTRSYMLFVGIVLAALLGAAFWAD
KAGILNCEHLFVLPLSLIGGMLLYIFLQSRCGKVLALAGLCICFYLSLIYGVAISLSEER
SAKGLGELLANTSNTKAGVYGAYPTSAVFYSGKVLVKLLPAERMSTYRPQGLSWNSKNVM
PFADLDAENYSVVIVKNNSLNRFLQNNHKNWLIDACSGKWLLLRQLS

Enzyme Prediction     

No EC number prediction in MGYG000004816_00007.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	2	460	3.1e-107	0.8833333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.64e-51	1	357	6	364	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.19e-33	1	331	2	335	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	4.44e-23	59	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	4.23e-11	31	225	32	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	1.16e-05	59	190	86	229	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	1.34e-221	1	524	1	525
ADB46704.1	5.27e-141	1	482	1	494
AEQ23377.1	1.16e-139	1	482	1	494
AVO27725.1	6.27e-128	13	527	35	510
AVO74995.1	7.06e-127	13	527	35	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.15e-32	6	323	33	358	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KGY4	1.00e-28	31	334	30	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	1.35e-28	31	334	30	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
O67270	3.37e-27	1	377	1	371	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B4TBG8	1.27e-25	4	334	6	335	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
Q3KCC9	2.55e-25	31	331	50	352	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.946254	0.052615	0.000718	0.000097	0.000082	0.000254

TMHMM  Annotations     

start	end
5	27
80	102
109	126
130	149
156	170
174	191
203	225
252	271
291	313
336	358
370	389
394	416