CAZyme Information: MGYG000004813_02475

Basic Information

• Species: Proteus sp003144505
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus sp003144505
• CAZyme ID: MGYG000004813_02475
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		21546.3	4.4626

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004813	3063039	MAG	China	Asia

• Gene Location: Start: 29; End: 586 Strand: +

Full Sequence      

MITDEDRQDLKQTVDFVSFSYYMTGCITADKEEYEMKRGNILSMVPNPYLESSEWGWQID
PKGIRIVLNLLWDRYQRPLFVVENGLGAIDKVTPEGEINDDYRIQYINDHLVQIGEAIED
GIDVMGYTSWGPIDLVSASKAEMSKRYGFIYVDRDDQGKGSLERKRKKSFYWYQSIIQSQ
GELLR

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	181	4.6e-52	0.3706293706293706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	3.90e-96	2	184	291	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	2.01e-82	2	182	293	475	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	1.45e-80	2	184	292	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	1.43e-79	2	182	278	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	6.19e-68	2	182	275	453	Glycosyl hydrolase family 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTP88633.1	1.37e-130	1	185	270	454
AYY80419.1	1.84e-130	1	185	279	463
QLR01597.1	8.56e-119	2	185	280	463
QPE17864.1	8.56e-119	2	185	280	463
AXH63141.1	8.56e-119	2	185	280	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.75e-83	2	184	286	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	7.40e-71	5	184	301	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	3.79e-62	3	182	296	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.06e-61	3	182	296	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	1.46e-61	4	184	298	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26206	2.78e-103	2	184	281	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q48409	2.82e-100	2	185	280	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	4.11e-93	2	185	280	463	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
Q46130	1.90e-83	4	184	287	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	6.08e-81	2	184	286	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000032	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004813_02475.