CAZyme Information: MGYG000004805_00047

Basic Information

• Species: Acidaminococcus fermentans_A
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus fermentans_A
• CAZyme ID: MGYG000004805_00047
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000004805_1|CGC1	40627.48	6.645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004805	2557512	MAG	China	Asia

• Gene Location: Start: 45560; End: 46696 Strand: -

Full Sequence      

MTKVFISAGEASGDLHAAALTRAILQQDPAAQVFGMGGDALAAAGGEVVFDYKEYSVMGF
VEVLQSLPRLFGLKKAFRRIMEDRKPDVFVTVDYPDFNMRVAKEAKALGIPVFSYIPPSA
WAWRRGRAKEVARLATKVACIYPFAADVYQAAGAPVEFVGNPLVDIVQPSLSPQEGEAFI
GKRPGRPVVLLLPGSRVKEITGVLPVMLQALPLIRAQRPEVDFVLQKAPSIDGALLQGIL
AASPVPIKVVEGHNYDVMTACDAALATSGTVTLEAALCGLPSVICYTASPLSMWIAKHMV
YVKYIGLPNILAGKEILPELIQENMTPDHMAASILHFLEPETAAAVREEMRQAAAKLGQP
GAVERTAKLILETAKENP

Enzyme Prediction     

No EC number prediction in MGYG000004805_00047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	1.2e-121	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.96e-124	1	378	1	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.16e-108	1	376	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.88e-84	4	372	1	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	6.93e-48	1	328	1	307	lipid-A-disaccharide synthase.
PRK01021	lpxB	5.08e-38	5	334	230	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB48042.1	4.69e-245	1	378	1	378
AEQ21864.1	1.77e-184	3	376	2	375
QTV78315.1	1.13e-143	1	376	6	381
BBG63223.1	8.32e-140	1	376	1	376
QNP77898.1	8.32e-140	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.86e-54	4	375	9	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.34e-53	4	375	9	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	2.04e-96	3	372	8	378	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	3.70e-94	3	372	8	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	6.58e-89	3	372	6	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	6.58e-89	4	377	6	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	6.65e-86	3	377	8	383	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004805_00047.