CAZyme Information: MGYG000004799_00979

Basic Information

• Species: Schaedlerella sp900765975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella sp900765975
• CAZyme ID: MGYG000004799_00979
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1196		131193.88	4.4875

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004799	2888994	MAG	China	Asia

• Gene Location: Start: 46; End: 3636 Strand: -

Full Sequence      

MKTRFKKFVGISMATVMSVSLLSTTALAEPPATEPAPLANDNLLRLWYDEPADQNDWYAW
ETQALAIGNGYMGGLLYGGVKKDKIHINEKTVWSGGPTENLDYNYGNGNPTETEEDLQKI
KDDLNAIREKLEDKSEYVFGFSEDSYVPQGTSTKGEAMEWLNKLMGNLAGYAGPQDFANL
YISNDAIDESKVENYVRDLDMRTALSTVNYDYEGVHYTREYFNSHPDNILVVRLTADQSG
KITFKTDLSDCTGTGSSTVDGDTITMSSTLWSNKLNTEAQLKVINDGGELTSDGTSISVT
DADSAILILACGTDYKMELPTFRGENPHEAITSRIVSAANIISEEGYDALKKRHVDDHSA
LFSRMELNFNEEIPQIPTDELIKKYRNMVDNNGGEIPTESEQRALEIMCYQFGRYLTIAG
SREGSLPTNLQGVWGEGSFAWGGDYHFNINVQMNYWPTLASNLSECHIPYNDYLAVLREA
GRGAAASAFGIKSNEGEENGWLVGCFSTPFMFATMGQQYNAAGWNPIGSAWALLNCYEYY
LYTGDQEYLRNELYPSMKEVANFWNEALYWSESQQRYVSSPSYSPENGPIVSGASYDQQF
IWQHFENTIQAAKTLGVDEDLIAVWEEKQSKLNPVIVGDSGQVKEWFEETTFGHAKAGDL
PEINIPLWRESLGAQGGGEQPPHRHLSHLMALYPCNIISKDNAEFMDAAIVSLKERGLDA
TGWSKAHKLNLWARTGHSEEAFQIVQSAVGGGNSGFLTNMFSSHGAGANYKQSPIFQIDG
NFGYTAGVNEMLLQSQLGYVQFLPALPEQWNTGYVNGIVARGNFVVDMKWTDGVAESFKI
TSRNGGEFIGEYPNLSEYVVKDSAGNFVATSVPSDDVNKLSFSTTPGESYTISKATTYNI
SITETENGTVSAPTTANEGSSVALTVTPNDTYVIEGITVTDASGNPIETTVQEDGSYTFT
MPSSDVTVTATFKKDIPVEVSYNINITDTKNGIVEGPKTAIENSNVELVTKPAKGYVVAN
VVINTVDGQAIKATDQGNGIYTFTMPASDVNVNVTFKPESTAETTYQVTITKSEHGKVTV
PQTSYTEGSNVVLTVTPDKGYKLDKITATTKDNKEIKLKKQKDGTYSFEMPASDVTIKAS
FKTTGKPAAPTNKPSKPGTPPKTGDYSNLAMWTILGLVSLGSAATLTLNKKRRNNR

Enzyme Prediction     

No EC number prediction in MGYG000004799_00979.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	42	848	1e-239	0.9750692520775623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	6.48e-55	46	317	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
pfam18998	Flg_new_2	5.11e-13	898	975	1	73	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.
pfam18998	Flg_new_2	3.67e-09	1066	1142	1	71	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.
pfam03632	Glyco_hydro_65m	2.95e-04	530	675	122	264	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
pfam00746	Gram_pos_anchor	6.05e-04	1152	1195	1	43	LPXTG cell wall anchor motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL25699.1	0.0	1	892	1	888
AMP52821.1	1.17e-265	435	892	1	456
QGH70015.1	2.64e-245	5	935	2	908
AZM50986.1	1.20e-242	42	892	30	845
QRT30093.1	4.44e-190	44	892	47	898

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EAB_A	1.03e-148	46	894	20	896	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	7.72e-148	46	894	20	896	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]
2EAE_A	1.47e-147	46	894	19	895	ChainA, Alpha-fucosidase [Bifidobacterium bifidum]
2RDY_A	6.89e-103	44	842	3	744	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	2.62e-99	44	886	22	769	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	2.88e-83	62	842	64	804	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	3.58e-73	46	839	23	766	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q2USL3	9.34e-56	59	841	25	706	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2
Q5AU81	5.33e-53	67	846	46	792	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.998991	0.000165	0.000227	0.000176	0.000147

TMHMM  Annotations     

start	end
1169	1188