CAZyme Information: MGYG000004799_00518

Basic Information

• Species: Schaedlerella sp900765975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella sp900765975
• CAZyme ID: MGYG000004799_00518
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	MGYG000004799_9|CGC1	56104.26	4.2902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004799	2888994	MAG	China	Asia

• Gene Location: Start: 35949; End: 37478 Strand: -

Full Sequence      

MAENLKLEIGGLKALREMNPMLMSYNVEFAEVTGGTFWKAYTPGQVAGTEEFYVEPTKEG
IQAMYRDLMQVYAPINLYDEKLRKLAKELGPAWVRVSGTWATKTYYDFDGTTNGVVPEGY
LNVLTKEQWIGVLDFVKEIGAKLIVSVANCPGLHSAEEPWTPVEAEKLFGLSKEYGVPID
AAEFTNEPNMMEETGFPKGYTPEHYRRDQDLFFKWLKANYPECIAVGPSTTGGDNISFGK
GNEDAAAGGIEQLAMQTCDCADLLDGTTEPLEVFSYHYYNGVSERLASVMPNAHWSAEEA
NSEAYLETAINFARTYAPLRDKYVPGGEMWVTESGDAGGGGDTWASTYLDVLRTLNELAG
FSVITNGVIFHNTLASSDYGFLAREVFDPRPNYFAVLLWNRLMGATVYDTKEPVRYGAHV
YAHSRKDGKEGLVYLVINNSLEDVTSVELPKEAEVYMLAGEDGNMRASVMTLNGTPLVLG
ENNAVPEMNPVKVEGVLEVAPGSCAFIVL

Enzyme Prediction     

No EC number prediction in MGYG000004799_00518.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	76	509	2.4e-69	0.9384615384615385

CDD Domains     

MGYG000004799_00518 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98036.1	1.12e-293	1	509	1	509
SQG83426.1	1.95e-273	1	509	1	509
AUC25236.1	1.95e-273	1	509	1	509
SQG46560.1	1.13e-272	1	509	1	509
CAR42634.1	1.60e-272	1	509	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RG8_A	3.24e-08	269	490	132	357	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5E8M_A	9.17e-06	325	488	181	357	Crystalstructure of human heparanase [Homo sapiens],5E97_A Glycoside Hydrolase ligand structure 1 [Homo sapiens],5E98_A Crystal structure of human heparanase in complex with HepMer M04S02a [Homo sapiens],5E9B_A Crystal structure of human heparanase in complex with HepMer M09S05a [Homo sapiens],5E9C_A Crystal structure of human heparanase in complex with heparin tetrasaccharide dp4 [Homo sapiens],5L9Y_A Crystal structure of human heparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens],6ZDM_AAA Chain AAA, Heparanase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L608	3.78e-16	75	509	72	530	Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1
X4Y2L4	5.72e-16	75	509	40	479	Hyaluronoglucuronidase OS=Hirudo nipponia OX=42736 PE=1 SV=1
B2RY83	9.59e-10	123	490	187	560	Inactive heparanase-2 OS=Mus musculus OX=10090 GN=Hpse2 PE=2 SV=1
Q8WWQ2	9.59e-10	123	490	187	560	Inactive heparanase-2 OS=Homo sapiens OX=9606 GN=HPSE2 PE=1 SV=3
Q6YGZ1	1.67e-06	269	509	280	526	Heparanase OS=Mus musculus OX=10090 GN=Hpse PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004799_00518.