CAZyme Information: MGYG000004797_01964

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_01964
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757	MGYG000004797_25|CGC1	83992.88	5.394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 15222; End: 17495 Strand: -

Full Sequence      

MCTNKFILFCMGIVMSVSSSAWAGDDTPLYKDRTAPIEKRVDDLMSRMTLHEKVLQLQNR
ASGRLDEIDRIFAGESYGTTHEMSMSAYDCAVMYKELQHYMRTKTRLGIPLLTSAEGIQG
IIQNNCTLFPHALAQGSTFNPELIQQMTEAAGEEAKAIGIHQILSPVFDIARELRWGRIE
ETYGEDPYLIAEMGVAFIKGYQKHRITCMPKHFVAHGTPSGGLNCAGVSGGERELRSLYL
YPFRKAIRETSPWAVMTCYSAYDGVPVTGSSYYMTDILRGELGFKGYTYSDWGSVERLMT
FHHAAGSREEAARMALMAGVDLNIDSTYETLEKQVEEGRLDVAYIDQAVRRILTVKFELG
LFDETYGDPKLVKKVVRNAEKVALAKKVADESAVLLENRNDILPLDLNKYKSVAVVGPNS
NQAVLGDYAWTMGDTKEAVSLLQGLQESAGDKIMIRHAEGCDWWSQDKSHIAEAVEVVRN
SDIAVVAVGTRSTYLGRSPKYSTAGEGFDLSSLELPGVQEELLKEIKKTGKPMIVVLIAG
KPLAMPWVKENADAVLVQWYAGEQQGCTLADILLGKVNPSGKLNVSFPRSTGNTPCFYNH
FVTDREEPFDQPGTPEEPKGHYIFDKPEPLWNFGHGKSYTTFDYVDCALSDTLLVASDTL
KVSVTIKNTGRRDGKEVVQLYVRDKVSTVATPIQQLKAFQKVLVKPGESQCVELSLPIAE
LALYNAKMEEVVEPGDFEIQIGAASDDIRFKKTITIN

Enzyme Prediction     

No EC number prediction in MGYG000004797_01964.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	103	323	6.1e-69	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.54e-179	11	749	7	758	beta-glucosidase BglX.
COG1472	BglX	9.96e-95	48	453	1	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.11e-74	6	756	9	779	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.50e-73	104	355	61	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	6.23e-66	393	639	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK83130.1	0.0	1	757	1	757
ABR38447.1	0.0	1	756	1	756
QQY38586.1	0.0	1	756	1	756
BCI61926.1	0.0	5	756	2	752
QQA08973.1	0.0	14	756	14	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	3.05e-175	25	756	2	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.42e-174	25	756	2	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	3.88e-137	23	749	32	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	2.15e-127	38	745	4	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.18e-126	38	745	4	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	6.07e-150	8	749	4	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.90e-122	41	749	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	3.18e-121	30	753	29	750	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	1.27e-118	11	752	7	759	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q23892	2.54e-94	41	742	80	812	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000274	0.999059	0.000212	0.000150	0.000148	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_01964.