CAZyme Information: MGYG000004797_01821

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_01821
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000004797_22|CGC2	40893.44	5.6492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 36905; End: 37990 Strand: -

Full Sequence      

MKVKTLLCINVFVLCLSSCGVSMEKSTPETQKLLSNLQLMSSRGIMFGHHDDTVYGIGWE
GDEGRSDVKSVCGDYPAVISFDLGEIELGKDENLDKVSFDKIRKEIINQYERGGMVSLSW
HARNPLTGGDAWDISDTTVVRSILPGGSRHDKFINWMDCVATFLNSLKDPEGIKVPVLFR
PWHEHTGSWFWWGEKLCSSADYKKLWRMTVESLKAKGVNNVLYAYSSSSNLQDSCQYLER
YPGDDLIDVMGFDAYQADSLSFVKDMKSSLNILGEIGKKHNKMIAVTETGYESVPDAKWW
TDTLLPLIKGFPLSYVLVWRNARERPTHYYAPYPGQVSAGNFVEFYNDSRTLFVSNVNLY
E

Enzyme Prediction     

EC	3.2.1.-	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	25	297	1.1e-64	0.8415841584158416

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.86e-35	26	255	5	230	Glycosyl hydrolase family 26.
COG4124	ManB2	7.12e-15	132	361	144	343	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48889.1	5.35e-247	1	361	1	361
QUT33719.1	7.76e-187	16	361	16	371
QUU00579.1	7.76e-187	16	361	16	371
QQA30566.1	7.76e-187	16	361	16	371
QUT62100.1	7.76e-187	16	361	16	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	1.54e-164	20	361	3	344	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	1.15e-82	25	353	37	387	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	1.15e-82	25	353	37	387	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	2.23e-82	25	353	60	410	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	9.11e-82	25	353	37	387	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	5.75e-54	24	353	52	407	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	2.90e-43	17	359	38	400	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
G2Q4H7	7.41e-20	68	305	211	450	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.81e-18	68	302	189	418	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55278	4.24e-18	24	258	35	269	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_01821.