CAZyme Information: MGYG000004797_00066

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_00066
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	MGYG000004797_1|CGC2	46598.94	4.9762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 116970; End: 118193 Strand: +

Full Sequence      

MNTKNLLVGIGLCLLSACTEVDNKLEVDRALEYCDRQVHRTLEVMHGKGREVDYTMMPRN
IMDGQYDWNYRKVSKEEWCGGFWPGILWYDYEYTQDPKIKEEAEKFTASLKFLSEIPAYD
HDLGFLVFCSYGNGYRLTGNPEYKQVIINTADSLSALFNPCVGTMLSWPRNVEMFGGHNT
IMDNMINLEMLFWAAKNGGNPYLFDIAVAHADKTMKYHFRPDYTSYHVAVYDTLTGEFIK
GVTHQGYSDDSMWARGQAWAIYGYTVVYRETKDVRYLDFVQKVTDVYLKNLPEDYVPYWD
FNDPSIPDAPRDASAACVVASALLELSGYLPAEKALEYKQAAVKMLTSLNSDKYQCGKSK
LAFLLHSTGHLPAGSEIDASIIYADYYYMEALLRLKRLTENKPVIDE

Enzyme Prediction     

No EC number prediction in MGYG000004797_00066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	72	395	6e-125	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.58e-16	50	270	4	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW35632.1	1.86e-309	1	407	1	407
ABR37845.1	7.57e-309	1	407	1	407
QQY39821.1	7.57e-309	1	407	1	407
QJR69439.1	3.60e-307	1	407	1	407
QJR65176.1	3.60e-307	1	407	1	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.38e-89	56	404	54	394	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	5.54e-59	24	394	25	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	5.69e-59	24	394	26	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	7.98e-59	24	394	26	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	3.10e-58	24	394	26	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	7.08e-86	72	398	71	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	3.11e-58	24	394	26	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	5.83e-58	66	394	55	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	1.23e-54	60	397	26	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	2.38e-52	67	394	59	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_00066.