CAZyme Information: MGYG000004792_01540

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus
• CAZyme ID: MGYG000004792_01540
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		40415.05	7.762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004792	1933522	MAG	China	Asia

• Gene Location: Start: 21263; End: 22360 Strand: +

Full Sequence      

MKRQLIIGLMAGLTIFGNASGALAASVSEDAYQDARQAVLNRQLVDENQVKQRGDEYASA
FLSALAQVGQVYEQAFRQGVNDGLQGHPAQPGGDDVAVTAYQRGFARGQNFRSGNQPAPS
DGEVTTNGGMADNQLPEESGPDSSEYPLKHPSPAQAAFIARIAKDAQRIGAEFDLYPSII
IAQAALESNWGTSDLARKPYHNLFGVKGAFQTRSVLQPTVEFDKEGHRHEIKDYFRWYDN
DYQSLHDYAQTLEDPLYDGVHRRAAKSYRQATRALLGRYATDPHYDRKLNEIISNFQLTK
YDHQPQRTAMHRPAVFKEPPMAPTSSHEVKASRVHHPHRVTWLSILGGAGSAGAITLLRR
FALVK

Enzyme Prediction     

No EC number prediction in MGYG000004792_01540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	163	298	5.5e-30	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.83e-51	155	302	43	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	3.85e-48	134	303	299	473	amidase domain-containing protein.
PRK06347	PRK06347	2.13e-38	157	302	152	303	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	3.02e-31	156	302	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	2.80e-21	112	293	108	294	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN92542.1	8.00e-253	1	365	1	364
QFV01117.1	2.29e-90	1	363	3	381
QFS34532.1	2.99e-74	1	361	1	348
QFG72894.1	1.41e-73	142	361	2	220
QLQ62599.1	2.06e-69	9	360	7	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	3.16e-32	155	302	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.60e-29	158	302	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	5.59e-13	158	303	6	155	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.41e-12	158	297	6	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	2.09e-10	163	294	13	144	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39046	3.17e-28	156	302	63	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	5.10e-28	158	302	323	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9CIT4	6.95e-28	157	302	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	1.76e-27	158	302	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	4.53e-27	157	302	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000257	0.998948	0.000178	0.000214	0.000192	0.000165

TMHMM  Annotations     

start	end
5	27