CAZyme Information: MGYG000004790_00822

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000004790_00822
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734	MGYG000004790_20|CGC1	81707.75	4.6199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004790	1700914	MAG	Denmark	Europe

• Gene Location: Start: 1419; End: 3623 Strand: -

Full Sequence      

MKSRTIFSVASALLLGSALAGAQDYQYPFQNPSLSEDERLDNAVSLMTVDEKIGTVVGQG
VPRLGIDNPGSTEAIHGIVRGGANELPNMGFAGQFQQGGAAGQKKQEPQMVNSTAFPQAY
GIGETWDREMAHIVGDVMSYEARYYSQMTGRNCLVLWAPNADLARDPRWGRTEESFGEDP
YLVGEMVAAEVRGIQGDDPTYWRGASLMKHFLANSNEDNRYSTDSAFGEDLFRDYYAYGF
WKGAKAGAKSLMTAYNSYNGVPCMAHDFIKDVLYDEWGMDGTIVDDAGALRFMSSAHNYT
KDINESIKLAMEAGLTRFIDSNFDQVKAAYDGGYISDEVLDACTKSNLRTMLKLGLLDAE
CPYDEMEFGDTAPWETQEFKDKARLVTQKSVVLLKNEDNILPIDTRKVKKIAVFGNRAEK
VLKDWYGALPAYSVSPLDGIKAAVEGSDVEVKFQRWDSDGSAQKLAEWADVCIVCVGNHP
ATSPDWDQMSIQSPWAYGTVAGDGREALDRRSLQLETEDLIKVIWQANHNTVVALISSFP
FAINWTQEHVPGIVHLTQCSQELGNGLADVLFGKYNPAGRTTQTWVKDILDLPNLLDYDI
KNGRTYMYFQGEPLYPFGYGLSYTSFEYSNLKVDKKRDNFVFSFDLKNVGGRDGEEVVQI
YAKVSGDDAAKRLRGFDRIFVKAGETRKVEITVPAEDLMLWNSDKHQFELNKGEAQFMVG
ASSEDIRLTKTMKI

Enzyme Prediction     

No EC number prediction in MGYG000004790_00822.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	315	1.9e-51	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	8.88e-96	1	727	1	758	beta-glucosidase BglX.
PLN03080	PLN03080	2.80e-73	27	702	40	752	Probable beta-xylosidase; Provisional
COG1472	BglX	2.29e-47	62	445	56	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.51e-47	391	623	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.25e-34	48	342	1	308	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVR43989.1	1.33e-235	1	734	1	718
QGK76457.1	1.71e-230	1	734	1	717
AOE52533.1	3.55e-230	13	733	9	717
ALM48916.1	3.55e-230	13	733	9	717
ADQ80256.1	1.22e-227	1	734	1	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	2.96e-72	23	734	1	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.08e-71	23	734	1	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
2X40_A	9.23e-71	38	734	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.66e-70	38	734	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	2.08e-68	44	734	9	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.28e-76	14	724	6	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	7.02e-68	1	727	1	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	1.14e-67	44	734	9	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
Q56078	1.33e-67	1	727	1	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
D5EY15	6.35e-60	1	730	1	856	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.998998	0.000195	0.000192	0.000160	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004790_00822.