CAZyme Information: MGYG000004789_00476

Basic Information

• Species: Streptococcus sp001556435
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp001556435
• CAZyme ID: MGYG000004789_00476
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
190	MGYG000004789_7|CGC1	20352.98	4.3053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004789	2137490	MAG	China	Asia

• Gene Location: Start: 35682; End: 36254 Strand: +

Full Sequence      

MQKKNTSNTKKLGLFGLVTVATLGATALANAETYTVQKGDTLSAIAKKNGTTVDEIVSKN
GIQDANKISIGQNLTINETTEETTEPSVTTEATAESTQSTESTQSEDTQATNTNLSSSEA
AAKEEIAQRESSGSYTAQNGQYYGRYQLASSYLNGDLSPENQEKVADNYVASRYGSWTAA
LAFWNANGWY

Enzyme Prediction     

No EC number prediction in MGYG000004789_00476.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	7.76e-14	33	74	2	43	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	8.21e-13	33	74	1	42	Lysin motif.
pfam01476	LysM	1.93e-11	34	74	1	40	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK11198	PRK11198	1.82e-06	25	74	89	143	LysM domain/BON superfamily protein; Provisional
PRK10783	mltD	1.82e-05	22	74	334	385	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC48762.1	2.71e-116	1	190	1	190
ALR80896.1	1.06e-113	1	190	1	190
ARC23392.1	1.06e-113	1	190	1	190
QGU83587.1	1.23e-112	1	190	1	190
QGU79574.1	1.23e-112	1	190	1	190

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.999000	0.000183	0.000184	0.000175	0.000151

TMHMM  Annotations     

start	end
12	34