CAZyme Information: MGYG000004788_00231

Basic Information

• Species: Companilactobacillus farciminis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Companilactobacillus; Companilactobacillus farciminis
• CAZyme ID: MGYG000004788_00231
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	MGYG000004788_3|CGC1	50021.34	9.2757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004788	2403188	MAG	China	Asia

• Gene Location: Start: 10882; End: 12180 Strand: -

Full Sequence      

MIETFYVIAIITIWLSLIMMVVTLSGGVIFIFKHMQHTNVDKLPPLKRYPKVTLVVPAHN
EEIVIQDTVKAILNLNYPKDRYELLVYADNCNDQTAQKVRELMALKQYKDCNFRVIERTG
TGGKAGVLNDALKVSTGEYLGVYDADAAPEANALYFLVEKVLENPERYAAAFVRNKTRNY
QQNFLTRCINLEIVNTQRIQHTGLWQLFKIGRIPGTNFIINKKIVQSIGGWNDGALTEDT
AISFSLMREGKLIALAHRAEAFQQEPETLFAYYNQRKRWARGNYEVIMDNVKHLFDNTAW
RIKLEVFYYVCTFFWFNFAIIVSNGIFLLNLIVAITHAFFPQVHQIVSLGAPLSILFMVN
WLLMFFLYLLQMNIALASDYGQETVKNFMYTLVSYFTYAQLFIVVSVVAMWDIIRDKITG
KNNTKWYKTQRF

Enzyme Prediction     

No EC number prediction in MGYG000004788_00231.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	50	282	3.6e-24	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	7.06e-49	1	419	5	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	9.78e-49	54	239	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	1.35e-43	1	409	3	396	N-glycosyltransferase; Provisional
cd06421	CESA_CelA_like	5.81e-32	50	287	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK14583	hmsR	1.11e-28	17	335	39	351	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATO45418.1	1.01e-312	1	432	1	432
QMT85169.1	2.86e-287	1	432	1	432
AKP02979.1	2.86e-287	1	432	1	432
AKS51279.1	2.86e-287	1	432	1	432
QCX23691.1	3.88e-285	1	432	1	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	3.26e-15	49	290	272	509	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6YV7_B	5.19e-11	41	174	33	164	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	5.22e-11	41	174	34	165	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	5.28e-09	50	288	128	380	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	5.48e-09	50	288	140	392	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	7.30e-79	3	432	3	414	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8YMK0	1.12e-27	50	289	106	340	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	2.08e-27	50	289	106	340	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P74165	1.08e-26	24	307	75	361	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P75905	2.28e-20	19	315	41	332	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000017	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
10	32
313	335
350	372
392	414