CAZyme Information: MGYG000004786_01091

Basic Information

• Species: Firm-11 sp900550955
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp900550955
• CAZyme ID: MGYG000004786_01091
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706	MGYG000004786_17|CGC2	79793.61	4.9962

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004786	2686597	MAG	Denmark	Europe

• Gene Location: Start: 31236; End: 33356 Strand: -

Full Sequence      

MNKQSISFKGFVPFGTKLREQTVPLGNAIPVGAEILEQTDGKLTIRVPECGGGVLLTGLR
GNVGSVDWDAASWLAMDVTFPQPEQFALCLCLGFYRYDQAPEREAPYFGMLTGIFPNYQT
RISLGFEELACKNGFLPRTPGKLKTVAAGLPIAPNEISAVYIGARACHVPQVIELSNLFL
SDREPDYPMQNTKMVDALGQWTQKDWPGKMHSVEEMVRALQSELTAPTLPPIPRRNKWGG
DLDRKLTEGTGFYATYKDKNNKWWLVDPDGYAYFVMGLEMVAPGSSGVLNEWRDAYTWLP
EKEGEFAAAWSEMRGDPTRARRVAYSEDVDFAKINLIRAYGQDWERKWAELTIARLDAWG
INNVGVSGSPKGRLMASPLGKYRQYPCFHFVGNYPCTRATIFRDFPDVFSKEYEEAAANY
AANLETIKDIPDIVGYFMTNEPEWAFIEDLEISEMLLAHPEHLATKDVFIAFIKACYATI
DAFNSAWNLQLSSFDGLLHPIADARRLSETARKDLDAFSRIMIEQYIKVPALKCKEVDPN
HLNFGMRYPYIAYANQTAGHQYLDVFDINDYRYDPKDYINWIGSLVDMPVMVSEFHHGSL
DRGLPVTGIRGVRTQEERGVAYRYYVERGASTDYFVGSVYFVFSDQPILCTNYQENYNIG
FVDICQMPHTEITNAVRETAMAVYDVHAGTKANYQRQPDVIPLNAC

Enzyme Prediction     

No EC number prediction in MGYG000004786_01091.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	146	684	3e-95	0.8453292496171516

CDD Domains     

MGYG000004786_01091 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHW33563.1	7.65e-158	42	701	27	668
AEE96522.1	1.34e-148	68	701	47	659
BCJ99952.1	1.37e-136	33	703	13	666
QGG55910.1	4.24e-135	110	703	77	666
SQI63245.1	1.94e-132	49	702	16	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	3.38e-57	155	691	164	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	8.66e-57	155	691	164	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	3.41e-51	150	684	178	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	1.42e-43	192	685	220	760	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5T3B_A	4.07e-13	236	686	84	475	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	5.49e-40	194	684	431	949	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	4.60e-30	193	693	397	922	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004786_01091.