CAZyme Information: MGYG000004785_00844

Basic Information

• Species: Blautia_A wexlerae_B
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A wexlerae_B
• CAZyme ID: MGYG000004785_00844
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835	MGYG000004785_43|CGC1	96528.68	5.0596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004785	2654987	MAG	Spain	Europe

• Gene Location: Start: 4700; End: 7207 Strand: +

Full Sequence      

MGNILWSVDKKIYSDKEDHTLAITGWAITRDQSECDFILYGSGKELSVPEPSRCERADVA
KDLKETKDIKEVGNVGFTVKIPEIIKLAEEHEKLQLALRAGDEKEIIWEATAAEVKDFCE
ESLIEYHIDEEQITQESILTVRGWVVNQLEPDEIFVQGTDGKVLECTITRQRRPDVEEAK
GISEEEKRNLGFSITVNLENTNDQNICICFRGKDVQKIYTVNVKKIKRENTGLYQQMKLL
SLKNRQKNQEYIKKNGIGRFIRYVRNSQLKDGDQDYEDWLKDHVAFRKELKRQRNAVFSY
SPLISIVMVVTDTDEQRLKSVIDAYTEQTYGNWQLCLADACEGEETGEFLRKKYKKEIRL
SYKKVTENNGISGNLNASLKLAMGEYVLFAGQEIIPEPDALFQMVKAITEKKADMIYTDE
DEISADGKHYSEPEFKPDFNLFRLRENNYIGQFWAIRKEILEQAGKFDPEYDGAQDYDML
LRCSEQAENIVHIPKILCHSMKAENLITEEQEKKNWEAGRKALEEHYRRAEVPATAELAD
KKGWYRSHLTISGEPMISVIIPSKDHINDLELCISSIEEKTTWKNYEIIIVENNSVEKET
FVYYETLKNRYPNVRILTWKKEFNYSAINNFAVREARGEYLLFLNNDVEIITESWLEEML
QLCQQKDVGMAGAKLYYPDDTIQHAGVVVGLGGVAAHVLCKLPRDAEGYMGRLRCVQEIS
AVTAACMMVKTSVFKAVGGFDEELKVAFNDIDLCMKVRKYGVKIVFTPYAELYHYESKSR
GMEDTPEKQLRFSREVNCFRRKWERELLKGDPYYNPNLTLNNTDCSLRKQEKNGD

Enzyme Prediction     

No EC number prediction in MGYG000004785_00844.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	558	683	4e-21	0.7235294117647059
GT2	305	463	1.5e-16	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	7.45e-70	302	499	1	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.63e-44	559	776	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.20e-29	553	781	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.82e-18	558	680	1	120	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.29e-17	305	499	1	192	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24562.1	2.13e-284	1	829	1	811
QOV20089.1	1.35e-189	75	829	69	813
CBL36811.1	2.02e-189	124	834	1	719
CBK76130.1	2.02e-189	124	834	1	719
QRV18616.1	1.36e-187	124	835	1	724

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.41e-122	302	827	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.00e-92	275	835	292	848	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004785_00844.