CAZyme Information: MGYG000004781_01738

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS680
• CAZyme ID: MGYG000004781_01738
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		39038.1	10.2905

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004781	3497015	MAG	China	Asia

• Gene Location: Start: 11440; End: 12480 Strand: +

Full Sequence      

MKSIKKEEIKTKNYQKFCKMIAFFVCFCFLLSTTVISVSAKATPVSQNGRLSVKGNKIVN
QNGKAFVIKGVSTHGLSWFPQYVNKKAFKNMRDQWGVNTIRLAMYTEGYNGYMTGDANNK
KALKNLIHKGVTYAKELGMYVIIDWHILSDGNPKTYEKESKAFFKEMAKKYKNYNNVLFE
ICNEPNNVDWNTVKSYANQLVKAIRSVNSKAMIIVGTPTWSQDVDLAVASPVKGKNIAYS
FHFYAGTHKQDLRNKLESAVQKGLPVIVTEFGLSDASGNGAIDQREGNRWLTLLNQYKIG
RVCWNLSNKAEASALIQSSCQKVNGWKKRDLTEHGKWLMKAYGGTL

Enzyme Prediction     

EC	3.2.1.4	3.2.1.91

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	61	301	4e-93	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.63e-76	59	309	1	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.66e-14	16	296	5	267	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	0.004	96	299	37	265	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	0.006	75	215	55	220	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA47670.1	3.75e-128	43	343	197	499
AWW27905.1	1.98e-115	39	318	216	497
QNM00780.1	2.14e-115	43	344	213	514
QWT53734.1	1.10e-112	43	344	213	514
QBR94633.1	1.80e-110	49	339	92	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	1.14e-99	42	338	4	296	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
3PZT_A	2.13e-95	37	345	23	327	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZW_A	2.71e-95	43	338	4	298	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	1.13e-94	43	338	4	299	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1A3H_A	2.80e-78	45	338	3	293	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15704	8.35e-97	10	345	4	338	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P22541	3.42e-94	49	339	114	404	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P07983	1.02e-92	37	345	28	332	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	2.04e-92	37	345	28	332	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	1.80e-90	37	345	28	332	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001559	0.997466	0.000402	0.000201	0.000171	0.000165

TMHMM  Annotations     

start	end
21	40