CAZyme Information: MGYG000004779_00304

Basic Information

• Species: UMGS1397 sp900551425
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1397; UMGS1397 sp900551425
• CAZyme ID: MGYG000004779_00304
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613	MGYG000004779_2|CGC1	68671.71	4.5336

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004779	2688004	MAG	China	Asia

• Gene Location: Start: 16213; End: 18054 Strand: +

Full Sequence      

MNGGNCVKERYLVTGNEAVSLPTIRESDGGLEGISILYMAAKGMLEIVGSPLMAPFVEID
NEAILLTDFSWEWTRYWIPSFTARAGGVRVEGVILAPVGERGFCYRLKVVNQDFKEHQVR
YGLKGCWDKTLHSINESKLVDGERHAYGSGWNHAFVMDMRVGVSLFALAPIYTEQPEISH
TRCEYNPEQDGAVSYCFWRNETLEPGGEDAENFWFGVGFEEVAASTSAKEMLRQGFDKEY
EKTCRWLAARERSAGDPKLDELLNRNMFFSFFFGSGVTLDTEELVLVTSRSPRYYVSAAY
WDRDSLLWSFPAILMTDPDYAREMLGYVFGRQGRNVGIHSRFIDGTVLEPGFELDELCAP
VLALAGYVRETGDRTVLAQPDIASGVEHILRLLAEKKHPEIALYETMLQPTDDMHVYPYL
TYDNALVSRILRDLAELYEGIWPAERCKELSRMAEDVCAAVAAHCVKEKDGKPLYAWSVD
LEGNWDVYDEPPGSLLLLPFRGFCSPDDEVWKNTVAVIRREEYPYSFAGCPIAEIGCPHA
PHPWVLSIANSLLSGNRDLAREHLLLCVMDNGIACESVDEVTGESATGDAFATCAGFLAY
AIDQAFGEGKHHK

Enzyme Prediction     

No EC number prediction in MGYG000004779_00304.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	402	592	1.7e-20	0.49502487562189057

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3538	COG3538	1.43e-22	299	592	60	409	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
pfam06824	Glyco_hydro_125	6.17e-19	352	549	122	358	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET57195.1	5.60e-235	7	609	1	598
QRV21888.1	1.49e-232	7	609	1	598
QIA31705.1	1.97e-231	7	607	1	593
QQR05501.1	2.80e-231	7	607	1	593
ANU41635.1	2.80e-231	7	607	1	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QPF_A	2.02e-15	343	585	122	394	Analysisof a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]
3P2C_A	2.27e-13	299	558	87	399	Crystalstructure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	7.61e-13	299	558	105	417	Crystalstructure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	5.02e-12	349	558	154	397	Crystalstructure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10449	1.02e-07	284	587	131	478	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004779_00304.