CAZyme Information: MGYG000004774_02188

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370
• CAZyme ID: MGYG000004774_02188
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000004774_64|CGC1	41361.58	4.9453

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004774	2727188	MAG	China	Asia

• Gene Location: Start: 8589; End: 9662 Strand: -

Full Sequence      

MSVYENRLNLVADAMLTMKNNGIEEKFPISLIDIDCWEWPQGVGLYGLYKYYEFSKDEKI
LNFLIQWFDDRIKEGILEKNVNTTAPMLTLSYVYEITGKEEYLDLIKEWTAWIMEEKGLI
RTGDGCFQHMITKNPNQGEILIDTLFMTVLFLARAGVILHRQDCIDEANYQFLQHIKYLL
NKQEGLFYHGFNFDRNNNYGEIMWGRGNSWYTVAIMDYMEMVDLDAGLKRHFLTVYKNQV
KALKKYADSEEGLWHTVINDSSSYIELSASAGFLCGMMKGIRKGVISKDEYGATVQKALS
HLLDYIDEKGVVKNVSYGTPIGENAEFYKNIICCPMTYGQAMMIMALQEAMRYTTER

Enzyme Prediction     

No EC number prediction in MGYG000004774_02188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	352	4.4e-95	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.28e-94	5	352	6	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.17e-80	13	353	5	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94867.1	2.14e-187	8	351	11	354
SET87383.1	5.04e-170	5	351	8	354
ANY67857.1	9.81e-133	7	354	10	353
AGX06452.1	2.34e-132	5	357	9	358
APO45381.1	5.63e-132	3	355	6	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	1.06e-81	37	352	66	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.63e-80	37	352	65	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	4.31e-69	7	352	11	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	2.32e-22	35	286	21	283	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.41e-11	121	328	183	387	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	9.59e-47	37	331	29	315	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004774_02188.