CAZyme Information: MGYG000004767_01057

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus
• CAZyme ID: MGYG000004767_01057
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206	MGYG000004767_4|CGC1	23382.37	9.6804

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004767	1275923	MAG	China	Asia

• Gene Location: Start: 17054; End: 17674 Strand: -

Full Sequence      

MTKKKNSEFNLVRVFAAGLALIILLAGGLYYRRYAANEALLRQEQEQKEAALRSRENFIK
TVAPLAQKAAKPYGLFPSVTIAQACLESNYGQSALARQYNNLFGVKGSDPNTTKLLSTKE
YENGRWVEVTGRFQVYDSYSSAIQAHAQLLANGTSWNRSQYQHVLQAKTWRQQAQALYRD
GYATDPNYPAKLIDLIEQYHLDKYDN

Enzyme Prediction     

No EC number prediction in MGYG000004767_01057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	63	201	1.7e-36	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.79e-59	15	206	7	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.53e-37	48	205	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	3.71e-35	54	206	319	473	amidase domain-containing protein.
PRK05684	flgJ	5.85e-32	54	198	151	296	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	1.60e-26	55	205	160	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTQ39663.1	6.59e-86	3	205	6	208
AXQ20330.1	6.59e-86	3	205	6	208
CAX67367.1	6.59e-86	3	205	6	208
QLL68719.1	9.36e-86	3	205	6	208
QGY97124.1	1.33e-85	3	205	6	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	5.00e-29	41	205	12	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	3.13e-21	58	206	63	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.29e-18	56	198	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.82e-18	56	198	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.06e-16	58	196	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	8.06e-35	58	205	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
A2RHZ5	3.63e-30	2	205	17	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	3.71e-30	23	205	34	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	2.58e-29	23	205	34	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P39046	2.10e-21	58	205	65	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.926115	0.004702	0.001925	0.000042	0.000030	0.067214

TMHMM  Annotations     

start	end
9	31