CAZyme Information: MGYG000004760_01400

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; UMGS1783; UMGS1783
• CAZyme ID: MGYG000004760_01400
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000004760_265|CGC1	33252.36	4.1417

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004760	1646159	MAG	China	Asia

• Gene Location: Start: 1468; End: 2406 Strand: -

Full Sequence      

MLLVRCPETDGAAVAAEYHLGGYVLFGRDFKDRTREEVIAAIQGYQADAKIPLAIAVDEE
GGDVVRVSSNGNLAPAPFPAMQDVYRDGGLDGLVADAREKAALLSGLGINLNLAPVSDIT
ENTGAYIYRRTMGASAEETAAGVRAIVEATAETPVSGCLKHFPGYGDNVNTHTGIAVDER
PLESFWENDFIPIEAGIEAGVECVLVSHNIMNYVDDEHPASISASVHELLRGGLGFTGVV
MTDDMAMDAISLYGSDPYLLAVNAGNNFILTTDYKTAYETILAGVEEGSVAEDTIDRAVF
RILAWKYAKGIL

Enzyme Prediction     

No EC number prediction in MGYG000004760_01400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	47	270	8.8e-37	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	1.73e-51	1	303	9	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	6.99e-43	16	312	26	318	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	3.56e-26	21	255	27	261	beta-hexosaminidase; Provisional
PRK15098	PRK15098	3.52e-10	108	311	150	358	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCI59548.1	3.47e-107	1	312	73	392
QNM02560.1	1.15e-105	1	312	105	418
QNL44190.1	6.94e-103	1	312	71	383
BCT44094.1	1.10e-101	1	312	141	452
QUO36703.1	1.50e-99	1	312	72	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.25e-35	8	311	31	342	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
5BU9_A	2.77e-29	19	311	36	339	Crystalstructure of Beta-N-acetylhexosaminidase from Beutenbergia cavernae DSM 12333 [Beutenbergia cavernae DSM 12333],5BU9_B Crystal structure of Beta-N-acetylhexosaminidase from Beutenbergia cavernae DSM 12333 [Beutenbergia cavernae DSM 12333]
3BMX_A	5.04e-28	8	311	74	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.19e-27	8	311	48	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.35e-27	8	311	78	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4USG7	2.47e-30	1	249	1	253	Beta-hexosaminidase OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=nagZ PE=3 SV=1
Q8PB42	2.47e-30	1	249	1	253	Beta-hexosaminidase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=nagZ PE=3 SV=1
B0RX17	2.47e-30	1	249	1	253	Beta-hexosaminidase OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=nagZ PE=3 SV=1
Q8PMU1	1.37e-28	1	249	1	253	Beta-hexosaminidase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=nagZ PE=3 SV=1
Q3BVU6	1.90e-28	1	249	1	253	Beta-hexosaminidase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=nagZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004760_01400.