CAZyme Information: MGYG000004757_00351

Basic Information

• Species: UBA6398 sp900555645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp900555645
• CAZyme ID: MGYG000004757_00351
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		69404.91	6.2647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004757	2504990	MAG	China	Asia

• Gene Location: Start: 4543; End: 6420 Strand: +

Full Sequence      

MKTIFSAVFILVTSSCIAALPAANDQKAKSLKSKTPRVESIKIGGHLGECIDACFTHRVL
GENTEELIEPFRHKEEKNMWQTEFWGKWMLGAADMYRYTHNAQLYEKMKESVDKIIATQL
PDGYIGNYATGYRLKEWDVWGRKYVMRGLLEWYEISGNKAALEAARKEADCLMNELEQQG
KSIVETGNYRGMASASALNAIVKLYKATDDKKYLDFAEKIAADLESTKGPKLIEKALAGV
PVAARFPHPQSWYTYENGQKAYEMMSCYEGLLDLYAITGNETYFKAAKAATDNIIDTEIN
IAGSGSSHECWYGGKVLQARPTFHTMETCVTTTWLQLLNRVLSMTGESRYADFMEQTIYN
ALLASLKNDASRIAKYMPLEGVHTPGEQQCGMTTNCCNANGPRGFALIPKTAYTVKESEI
TVNFYAPSEATINIGGKNTVELVQTGDYPKGNTAEIKIGLKKKAGFTLRLRIPAWSKGSA
VTINGEAVKNVNSGDYLTLNRTWENGDAVAINFDMNPRVERLDNCEAIIWGPIALARDSR
FNDGFVDEAVTVVNNNGSVNLTPAEAPAWAWMSFKAPVVLGLDQIDHGNAKDVLFCDFAS
AGNTWNPSERYRVWLPEALDVTKAK

Enzyme Prediction     

No EC number prediction in MGYG000004757_00351.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	74	532	8.6e-64	0.9045801526717557

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.31e-73	79	536	54	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.26e-55	32	545	8	509	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	1.06e-04	84	260	411	593	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG1331	YyaL	1.59e-04	192	296	416	502	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04791	LanC_SerThrkinase	8.20e-04	117	226	111	236	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	3.38e-186	38	621	24	612
QDO67740.1	3.39e-38	93	623	93	655
QHS51661.1	5.59e-38	87	537	123	574
QDO71484.1	8.52e-38	91	623	102	653
BCS34744.1	1.24e-37	87	540	118	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.64e-36	93	542	70	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	2.06e-30	63	539	71	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	6.73e-24	87	522	81	537	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	6.38e-22	87	586	80	606	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	6.54e-22	87	586	80	606	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.49e-21	87	586	80	606	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000331	0.999023	0.000221	0.000147	0.000133	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004757_00351.